DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drpr and NimB1

DIOPT Version :9

Sequence 1:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_001260452.1 Gene:NimB1 / 34813 FlyBaseID:FBgn0027929 Length:403 Species:Drosophila melanogaster


Alignment Length:558 Identity:134/558 - (24%)
Similarity:173/558 - (31%) Gaps:229/558 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 ELYNVDVVYTELQSFQERGSTWCVTFPPRCSTYRIKHRVV--------------NKTKTIAKNRI 83
            |||. |:..||...|:....|       |.....:.||.|              ....||..:||
  Fly    32 ELYG-DIENTEYGDFESLSQT-------RERQQHLCHREVPSVFFQTERDSPVRGNGSTIYFHRI 88

  Fly    84 VRDCCDGYIAS--AGECVPHCS----EPCQHGRCISPEKCKC-------DHGYGGPACDINCPPG 135
             ..||.||...  |.||||.||    :.|::|.|.||..|:|       :||    ||...||..
  Fly    89 -EVCCAGYRRDPYANECVPDCSASSPDNCRNGFCRSPGVCECFAEFVRNEHG----ACIHTCPIA 148

  Fly   136 WYGRNCSMQCDCLNNAVCEPFSGDCECAKGYTGARCADICPEGFFGANCSEKCRCENGGKCHHVS 200
            .....|.:             :|.|.|.:.:.    .|.....|....||:.|....  :| ...
  Fly   149 CQHGRCYL-------------NGTCVCHQNFV----LDQETRQFCRPKCSQSCGTHE--EC-VAP 193

  Fly   201 GECQCAPGFTGPLCDMRCPD-GKHGAQCQQDCPCQNDGKCQPETGACMCNPGWTGDVCANKCPVG 264
            |:|.|:||:      .|.|| |                 |||              |||..|..|
  Fly   194 GQCDCSPGY------RRTPDLG-----------------CQP--------------VCAPDCGFG 221

  Fly   265 SYGPGCQESCECYKGAPCHHITGQCECPPGYRGERCFDECQLNTYGFNCSMTCDCANDAMCDRAN 329
                      :|.  ||     .||||..|:                                  
  Fly   222 ----------KCV--AP-----NQCECFAGF---------------------------------- 235

  Fly   330 GTCICNPGWTGAKCAERICEANKYGLDC-NRTCECDMEHTDLCHPETGNCQCSIGWSSAQCTRPC 393
               |..|.|       .:|||..| |:| |..||...:           |.|..|:.....|..|
  Fly   236 ---IKRPNW-------NVCEAECY-LNCENGLCESRYK-----------CHCREGYRYDVNTTSC 278

  Fly   394 TFLRYGPNCELTCNCKNGAKCSPVNGTCLCAPGW--RGPTCEESCEP---GTFGQDCALR-CDCQ 452
            .     |.|...|...||...:|  |.|.|..|:  .|..|...||.   |.:|:..|.. |.|.
  Fly   279 L-----PECSDNCGQGNGVCIAP--GVCRCFRGYEVHGAECRPKCESRFCGKYGRCVAPEICGCG 336

  Fly   453 NGAKCEPETGQCLCTAGWKNIKCDRPCDLNHFGQDCAKVCDCHNNAACNPQNGSCTCAAGWTG-- 515
            .|.:      .|      :|..||   |:.|                       |:|.:|.|.  
  Fly   337 EGQQ------HC------RNGSCD---DIEH-----------------------CSCPSGETHFI 363

  Fly   516 ERCERKCDTGKFGHDCAQKCQCDFNNSLACD--ATNGR 551
            :|| .|.|......:.::| :..||..||.:  |..||
  Fly   364 DRC-LKADRLSQHLNTSEK-RKHFNRQLAYEFNALIGR 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877 19/72 (26%)
EGF_CA 274..319 CDD:304395 8/44 (18%)
DSL <479..518 CDD:302925 6/40 (15%)
DSL <567..606 CDD:302925
NimB1NP_001260452.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.