DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drpr and CG11674

DIOPT Version :9

Sequence 1:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_572948.1 Gene:CG11674 / 32374 FlyBaseID:FBgn0030551 Length:344 Species:Drosophila melanogaster


Alignment Length:345 Identity:79/345 - (22%)
Similarity:106/345 - (30%) Gaps:121/345 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 CANDAMCDR------ANGTCICNPGWTGAK--CA---ERICEANKYGLDCNRTCECDMEHTDLCH 372
            |::||.|.:      .:..|||....:|.:  |.   ||:...|..|    ..|.|.|.:. :||
  Fly    29 CSSDAQCAQFERGRCVDMACICTARGSGERVPCTPLEERLKLTNIIG----GACPCPMPNA-ICH 88

  Fly   373 PETGNCQCSIGWSSAQCTRPC--TFLRYGPNCELTCNCKNGAKCSPVNGTCLCAPGWRGPTCEES 435
            .....|.||.|..|:...|.|  ..:..|.:||....|:...:.|                   |
  Fly    89 TRWQQCHCSEGHVSSDDRRRCLPAVVPVGGSCEFQQQCQRADRFS-------------------S 134

  Fly   436 CEPGTFGQDCALRCDCQNGAKCEPETGQCLCTAGWKNIKCDRPCDLNHFGQDCAKVCDCHNNAA- 499
            |    .|..|.    |.|  :.|...|:||..                ....|.:..||.:..| 
  Fly   135 C----IGNQCL----CLN--QFEFHEGRCLSV----------------LQSSCLEDKDCGSCGAS 173

  Fly   500 -CNPQNGSCTCAAGWTGERCERKCDTGK-FGHDCAQKCQCDFNNSLACDATNGRC---VCKQDWG 559
             |..:...|.|:..:.......||..|. :|..|.....|..|  |..|   |||   :|.    
  Fly   174 ICLTKTKRCGCSKNFVHNHNMTKCIKGSAYGDTCEHSSPCKLN--LGAD---GRCLDHLCV---- 229

  Fly   560 GVHCETNCRSGYY----------GENCDK---------VCR--------CLNNSSC--DP-DSGN 594
                   |||.:|          .||.|.         .|.        |.|:|.|  .| |..|
  Fly   230 -------CRSTHYPKRVANEVAKDENDDLDAVNNLERITCAPIVPFGALCRNDSECRMQPMDQEN 287

  Fly   595 CICSAG------WTGADCAE 608
            ...|.|      |....|::
  Fly   288 ATASIGHPMVCNWGECSCSK 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395 79/345 (23%)
DSL <479..518 CDD:302925 7/40 (18%)
DSL <567..606 CDD:302925 18/74 (24%)
CG11674NP_572948.1 EB 96..153 CDD:279949 19/85 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.