DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drpr and Wsck

DIOPT Version :9

Sequence 1:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_733018.1 Gene:Wsck / 318600 FlyBaseID:FBgn0046685 Length:791 Species:Drosophila melanogaster


Alignment Length:236 Identity:46/236 - (19%)
Similarity:83/236 - (35%) Gaps:55/236 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   770 VCRSGYTGDNCDELIASQRIADQS----ENSSRASVALTLVLMTLFACIIFAVFIYY-------- 822
            |.::.|:....|:.:.|  :.|.|    |....:.|||.:..:...:|::.::..|:        
  Fly   370 VTKTMYSRGTHDQHVTS--LDDFSYATFEKGQSSVVALAVTCVIFGSCLLLSLIAYFYLRYKTCR 432

  Fly   823 RRRVS-------NLKTEIAHVH---YTHDTNPPSWPPNHNFDNPVYGMQAETRLLPNN-MRSKMN 876
            .||::       .|:|.|....   |..:.:|....| .||...:..:......:|.| :|..:|
  Fly   433 GRRLTGGNTHEMTLQTPIIERENNGYLVEDDPLPHSP-ENFKQQLQQLVEGYERIPRNALRLNVN 496

  Fly   877 NF--DQR-------STMSTDYGDDCNASGRVGSYSINYNHDLLTKNLNADRTNPIVYNESLKEEH 932
            :.  |.|       ...:.|:..||..            |.|...:||.     ....:.|:|..
  Fly   497 DVIGDGRFGEIITGKVSTNDFARDCTL------------HVLCLDDLNG-----TTQAQLLRELR 544

  Fly   933 VYDEIKHKEGYKDPVKIYSKILFPEDEYDHLDYSRPSTSQK 973
            ...::|.:|...|   .|.....|:..|...:..|.|..:|
  Fly   545 QLSQLKRQEHLLD---FYGVSASPDWFYLIFEQQRMSLKRK 582

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
WsckNP_733018.1 WSC 42..115 CDD:280068
fn3 130..222 CDD:278470
TyrKc 493..746 CDD:197581 21/110 (19%)
PTKc 497..750 CDD:270623 20/106 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.