DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drpr and tek

DIOPT Version :9

Sequence 1:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:XP_009299388.1 Gene:tek / 30747 ZFINID:ZDB-GENE-990415-56 Length:1117 Species:Danio rerio


Alignment Length:184 Identity:68/184 - (36%)
Similarity:86/184 - (46%) Gaps:32/184 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 CPEGFFGANCSEKC-RCENGGKCHHVSGECQCAPGFTGPLCDMRCPDGKHGAQCQQDCPCQNDGK 238
            |..||:|.||:|.| ||.|||.|...:|||.|.|||.|..||:.|.:|:.||.|::.|.   ||.
Zfish   215 CRAGFWGPNCTESCPRCANGGVCDDTTGECVCPPGFRGHTCDIVCGEGRFGAGCKERCV---DGV 276

  Fly   239 CQP------ETGACMCNPGWTGDVCANKCPVGSYGPGCQESCECYKGAPCHHITGQCECPPGYRG 297
            |:.      :...|.|..||.|..|.:.||.|.||.||.:.|.|.||. |....| |.| .|..|
Zfish   277 CRALVFCLRDPYGCSCASGWRGLSCNDACPDGYYGAGCTQKCVCAKGR-CDRFRG-CVC-AGRHG 338

  Fly   298 ERCFD-----------ECQLNTYGFNCSMTCDCA-------NDAMCDRANGTCI 333
            .||.:           :.::|| |...|:.|..:       .|.....||.|.|
Zfish   339 SRCEEADSSPVISHLRDVEINT-GVELSVNCSASGRPAPLHGDITLITANRTTI 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395 17/55 (31%)
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
tekXP_009299388.1 Ig_Tie2_1 25..121 CDD:287411
EGF_2 224..255 CDD:285248 17/30 (57%)
IG_like 354..439 CDD:214653 10/39 (26%)
fn3 541..621 CDD:278470
FN3 633..717 CDD:214495
PTKc_Tie2 809..1111 CDD:133219
STYKc 817..1085 CDD:214568
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.