DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drpr and Dkk2

DIOPT Version :9

Sequence 1:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_001099942.1 Gene:Dkk2 / 295445 RGDID:1308639 Length:259 Species:Rattus norvegicus


Alignment Length:266 Identity:61/266 - (22%)
Similarity:84/266 - (31%) Gaps:103/266 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 KHGAQCQQDCPCQNDGKCQ-------PETG--ACMCNPGWTGDVCANKCPVGSYGPGCQESCECY 277
            |.|....|..||.:|.:|:       |..|  |||        ||..|          ::.|   
  Rat    67 KKGKSLGQAYPCSSDKECEVGRYCHSPHQGSSACM--------VCRRK----------KKRC--- 110

  Fly   278 KGAPCHHITGQCECPPGYRGERCFDECQLNTYGFNCSMTCDCANDAMCDRANGTCICNPGWTGAK 342
                  |..|.| ||    |.||                           .||.||        .
  Rat   111 ------HRDGMC-CP----GTRC---------------------------NNGICI--------P 129

  Fly   343 CAERICEANKYGLDCNRTCECDMEHTDLCHPETGNCQCSIGWSSAQCTRPCTFLRY-----GPNC 402
            ..|.|...:...||..|       |.|..|....|  ..:||.:  ..||.:.:.:     |..|
  Rat   130 VTESILTPHIPALDGTR-------HRDRNHGHYSN--HDLGWQN--LGRPHSKMPHIKGHEGDPC 183

  Fly   403 ELTCNCKNGAKCSPVNGTCLCAPG-WRGPTCEESCEPGTFGQDCALRCDCQNGAKCEPETGQCLC 466
            ..:.:|.:|..|:....|.:|.|. .:|..|.:..:.|:.|.:...||||..|..|:.       
  Rat   184 LRSSDCIDGFCCARHFWTKICKPVLHQGEVCTKQRKKGSHGLEIFQRCDCAKGLSCKV------- 241

  Fly   467 TAGWKN 472
               ||:
  Rat   242 ---WKD 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395 9/44 (20%)
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
Dkk2NP_001099942.1 Dickkopf_N 78..128 CDD:398399 22/108 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.