Sequence 1: | NP_001261276.1 | Gene: | drpr / 38218 | FlyBaseID: | FBgn0027594 | Length: | 1042 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001317149.1 | Gene: | DKK3 / 27122 | HGNCID: | 2893 | Length: | 364 | Species: | Homo sapiens |
Alignment Length: | 199 | Identity: | 47/199 - (23%) |
---|---|---|---|
Similarity: | 64/199 - (32%) | Gaps: | 61/199 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 283 HHITGQCECPPGYRGERCFDECQLNTYG-------FNCSMTCDCANDAMCDRANGTCICNPGWTG 340
Fly 341 AKCAERICEANKYGLDCNRTCECDMEHTDLCHPETGNCQCSIGWSSAQCTRPCTFLRYGPNCELT 405
Fly 406 CNCKNGAKCSPVNGTC--LCAP-GWRGPTCEE-----------SCEPGTFGQDCAL-RCDCQNGA 455
Fly 456 KCEP 459 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
drpr | NP_001261276.1 | EMI | 27..92 | CDD:284877 | |
EGF_CA | 274..319 | CDD:304395 | 8/42 (19%) | ||
DSL | <479..518 | CDD:302925 | |||
DSL | <567..606 | CDD:302925 | |||
DKK3 | NP_001317149.1 | None | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1218 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |