DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drpr and GAS6

DIOPT Version :9

Sequence 1:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_000811.1 Gene:GAS6 / 2621 HGNCID:4168 Length:678 Species:Homo sapiens


Alignment Length:345 Identity:80/345 - (23%)
Similarity:109/345 - (31%) Gaps:118/345 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 MTCDCANDAMCDRANGTCICNP--------------GWTGAKCAERICEANKYGLDCNRTCECDM 365
            :..:||..|:......|....|              |....:|.|.:|...    :.....|.|.
Human    23 LAAECALAALLPAREATQFLRPRQRRAFQVFEEAKQGHLERECVEELCSRE----EAREVFENDP 83

  Fly   366 EHTDLCHPETGNCQCSIGWSSAQCTRPCTFLRYGPNCELTCNCKNGAKCSPVNGTCLCAPGWRGP 430
            | ||..:|                       ||     |.|..|.|:..:..:|...|.     .
Human    84 E-TDYFYP-----------------------RY-----LDCINKYGSPYTKNSGFATCV-----Q 114

  Fly   431 TCEESCEPGTFGQDCALRCDCQNGAKCEPETGQ--CLCTAGWKNIKCDRPCDLNHFGQD---CAK 490
            ...:.|.|..        ||.:....|:...|.  |||.|||....||:  |:|...|:   |.:
Human   115 NLPDQCTPNP--------CDRKGTQACQDLMGNFFCLCKAGWGGRLCDK--DVNECSQENGGCLQ 169

  Fly   491 VCDCHNNAACNPQNGSCTCAAGWTGERCERKCDTGKFGHDCAQKCQCDFNNSLACDATNGRCVCK 555
            :  |||    .|.:..|:|.:|:     |...|    |..|....:|  .:|.||    |...||
Human   170 I--CHN----KPGSFHCSCHSGF-----ELSSD----GRTCQDIDEC--ADSEAC----GEARCK 213

  Fly   556 QDWGGVHCETNCRSGYYGENCDKVCRCLNNSSCDPDSGNCICSAGWTGADCAEPC--PPGFYGME 618
            ...|...|  .|..|:...:.:|.||       |.|.    |..|    .|.:.|  .||.|...
Human   214 NLPGSYSC--LCDEGFAYSSQEKACR-------DVDE----CLQG----RCEQVCVNSPGSYTCH 261

  Fly   619 CKER-----------CPEIL 627
            |..|           |.:||
Human   262 CDGRGGLKLSQDMDTCEDIL 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395 0/3 (0%)
DSL <479..518 CDD:302925 11/41 (27%)
DSL <567..606 CDD:302925 9/38 (24%)
GAS6NP_000811.1 Gla 53..92 CDD:306960 10/66 (15%)
EGF_CA 118..153 CDD:238011 12/42 (29%)
FXa_inhibition 160..195 CDD:317114 12/49 (24%)
EGF_CA 197..>227 CDD:214542 10/37 (27%)
vWFA <232..273 CDD:320736 14/55 (25%)
LamG 298..450 CDD:238058
Laminin_G_2 513..651 CDD:308045
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24035
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.