DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drpr and NimB2

DIOPT Version :9

Sequence 1:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_723857.1 Gene:NimB2 / 260645 FlyBaseID:FBgn0028543 Length:421 Species:Drosophila melanogaster


Alignment Length:409 Identity:107/409 - (26%)
Similarity:138/409 - (33%) Gaps:154/409 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 QSFQERGSTWC--------VTFPPRCSTY-----RIKHRV---------VNKTK----------- 76
            |:..|:||...        ||.||....|     ...|||         :|||:           
  Fly    74 QNHVEQGSAGFVRAEVFQPVTLPPLYGHYVQPVTPPAHRVQVLDETALFINKTRSAMASGVCYKE 138

  Fly    77 --TIAKNRIVRD----------------CCDGYIASA---GECVPHCSEPCQHGRCISPEKCKCD 120
              |.:..|..||                |||||..:.   ..|.|.|::.|::|.|.:|..|.|.
  Fly   139 VPTASLLRNSRDQFVGNGTTPDMSRIQVCCDGYERNPHIYRRCEPICADDCRNGICTAPNTCVCI 203

  Fly   121 HGYGGPA---CDINCPPGWYGRNCSMQCDCLNNAVCEPFSGDCECAKGY-----TGARCADICPE 177
            .|:...|   |...||.|           | .|.||:. ..:|:|.:||     |...|...|..
  Fly   204 PGHVRTAEGKCISTCPLG-----------C-GNGVCDE-RNECKCREGYSLEPETRKYCQPECKP 255

  Fly   178 G-FFGANCSEKCRCENGGKCHHVSGECQCAPGFTGPLCDMRCPDGKHGAQCQQDCPCQNDGKCQP 241
            | .||       ||....||..:.|....|.|...|:||                .|:| ||| .
  Fly   256 GCSFG-------RCVAPNKCACLDGYRLAADGSCEPVCD----------------SCEN-GKC-T 295

  Fly   242 ETGACMCNPGW------TGDVCANKCPVG-SYGPGCQESCECYKG---------------APCHH 284
            ..|.|.||.|:      ...:|:..|..| ..||   :.|||..|               .||  
  Fly   296 APGHCNCNAGYLKLQGRCEPICSIPCKNGRCIGP---DICECASGFEWDRKSAECLPKCDLPC-- 355

  Fly   285 ITG------QCECPPGYRGERCFDECQLNTYGFNCSMTCDCANDAMCDRANGTCICNPGWTGAKC 343
            :.|      ||:|..||    ..||.|.|....:|...|   .:..|...| .|||.||:.    
  Fly   356 LNGVCVGNNQCDCKTGY----VRDEHQRNICQPHCPQGC---QNGYCSAPN-FCICRPGFI---- 408

  Fly   344 AERICEANKYGLDCNRTCE 362
                    |.|:...:||:
  Fly   409 --------KSGIKGRQTCQ 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877 23/97 (24%)
EGF_CA 274..319 CDD:304395 18/65 (28%)
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
NimB2NP_723857.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.