DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drpr and Kdr

DIOPT Version :9

Sequence 1:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_037194.2 Gene:Kdr / 25589 RGDID:2965 Length:1343 Species:Rattus norvegicus


Alignment Length:417 Identity:76/417 - (18%)
Similarity:113/417 - (27%) Gaps:184/417 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 PVGSYGPGCQE--SCECYKGAPCHHITGQCECPPGYRGERCFDECQLNTYGFNCSMTCDCANDAM 324
            |:.||..|..:  :|..|...|.|||....:          .:|.                    
  Rat   431 PMDSYQYGTMQTLTCTVYANPPLHHIQWYWQ----------LEEA-------------------- 465

  Fly   325 CDRANGTCICNPGWTGAKCAERICEANKYGLDCNRTCECDMEHTDLCHPETGNCQCSIGWSSAQC 389
                              |:.|..:.|.|      ||:           |..:.:...|.:..:.
  Rat   466 ------------------CSYRPSQTNPY------TCK-----------EWRHVKDFQGGNKIEV 495

  Fly   390 TRPCTFLRYGPNCELT------CNCKNGAKCSPVNGT-----CLCAPGWRGPTCEESCEPGTFGQ 443
            |:....|..|.|..::      .|.....||..:|..     .:.....|||  |.:.:|.|   
  Rat   496 TKNQYALIEGKNKTVSTLVIQAANVSALYKCEAINKAGRGERVISFHVIRGP--EITVQPAT--- 555

  Fly   444 DCALRCDCQNGAKCEPETGQCLCTAG---WKNI---KCDRPCDLNHFGQDCAKVCDCHNNAACNP 502
                       ...|.|:...||||.   ::|:   |........|.|:....|  |.|..|...
  Rat   556 -----------QPTEQESVSLLCTADRNTFENLTWYKLGSQATSVHMGESLTPV--CKNLDALWK 607

  Fly   503 QNGSCTCAAGWTGERCERKCDTGKFGHDCAQKCQCDFNNSLACDATNGRCVCKQDWGGVHCETNC 567
            .||:.                               |:||                      || 
  Rat   608 LNGTV-------------------------------FSNS----------------------TN- 618

  Fly   568 RSGYYGENCDKVCRCLNNSSCDPDSGNCICSAGWTGADCAEPCPPGFYGMECKER-C--PEILHG 629
                     |.:.....|:|.. |.||.:|||               ...:.|:| |  .:::..
  Rat   619 ---------DILIVAFQNASLQ-DQGNYVCSA---------------QDKKTKKRHCLVKQLVIL 658

  Fly   630 NKSCDHITGEILCRTGYIGLTCEHPCP 656
            .:....|||.:..:|..||.|.|..||
  Rat   659 ERMAPMITGNLENQTTTIGETIEVVCP 685

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395 7/44 (16%)
DSL <479..518 CDD:302925 8/38 (21%)
DSL <567..606 CDD:302925 9/38 (24%)
KdrNP_037194.2 Ig 224..325 CDD:416386
Ig strand A 224..228 CDD:409353
Ig strand A' 234..238 CDD:409353
Ig strand B 240..249 CDD:409353
Ig strand C 256..261 CDD:409353
Ig strand C' 264..266 CDD:409353
Ig strand D 270..278 CDD:409353
Ig strand E 286..294 CDD:409353
Ig strand F 304..310 CDD:409353
Ig strand G 315..321 CDD:409353
Ig 329..417 CDD:416386
Ig strand A 329..332 CDD:409353
Ig strand A' 339..343 CDD:409353
Ig strand B 345..356 CDD:409353
Ig strand C 360..366 CDD:409353
Ig strand C' 368..371 CDD:409353
Ig strand D 376..379 CDD:409353
Ig strand E 381..386 CDD:409353
Ig strand F 394..402 CDD:409353
Ig strand G 408..417 CDD:409353
Ig_3 547..641 CDD:404760 34/190 (18%)
IGc2 676..740 CDD:197706 6/10 (60%)
Ig strand B 680..684 CDD:409353 1/3 (33%)
Ig strand C 693..697 CDD:409353
Ig strand E 716..720 CDD:409353
Ig strand F 730..735 CDD:409353
VEGFR-2_TMD 755..789 CDD:375470
PTKc_VEGFR2 822..1163 CDD:270681
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1267..1314
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.