DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment drpr and Fgfr4

DIOPT Version :9

Sequence 1:	NP_001261276.1	Gene:	drpr / 38218	FlyBaseID:	FBgn0027594	Length:	1042	Species:	Drosophila melanogaster
Sequence 2:	XP_006253668.1	Gene:	Fgfr4 / 25114	RGDID:	2612	Length:	801	Species:	Rattus norvegicus

Alignment Length:	96	Identity:	20/96 - (20%)
Similarity:	35/96 - (36%)	Gaps:	39/96 - (40%)

- Green bases have known domain annotations that are detailed below.

  Fly   942 GYKDPVKIYSKILFPEDEYDHLDYSRPSTSQKPHYHRMNDAMLNINQDEEKPSNVKNMTVLLNKP 1006
            |::..::|.|  ..|||...:|..:|.|.:.                       |.|:|::::..
  Rat    78 GWRGRLEIAS--FLPEDAGRYLCLARGSMTV-----------------------VHNLTLIMDDS 117

  Fly  1007 LPPTEPEPQHECFDNTNTNLDNVSTASPSSS 1037
            ||              :.|.::..|.|.|||
  Rat   118 LP--------------SINNEDPKTLSSSSS 134

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
drpr	NP_001261276.1	EMI	27..92	CDD:284877
		EGF_CA	274..319	CDD:304395
		DSL	<479..518	CDD:302925
		DSL	<567..606	CDD:302925
Fgfr4	XP_006253668.1	IG	40..108	CDD:214652	9/54 (17%)
		IGc2	47..104	CDD:197706	8/27 (30%)
		Ig	153..237	CDD:299845
		IG_like	158..237	CDD:214653
		IG_like	252..346	CDD:214653
		Ig3_FGFR-2	260..347	CDD:143266
		PKc_like	453..766	CDD:304357
		Pkinase_Tyr	466..742	CDD:285015
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG0200
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900