DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drpr and Ret

DIOPT Version :9

Sequence 1:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_036775.2 Gene:Ret / 24716 RGDID:3556 Length:1115 Species:Rattus norvegicus


Alignment Length:384 Identity:73/384 - (19%)
Similarity:102/384 - (26%) Gaps:174/384 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KRRE--------LYNVDVV---------YTELQSFQERGSTWCVTFPPRCSTYRIKHRVVNKTKT 77
            ||:|        :::.|||         ||   |....|.:|..      .|:|::| ..|:|..
  Rat   287 KRKEGTVVATLQVFDADVVPASGELVRRYT---STLLSGDSWAQ------QTFRVEH-TPNETLV 341

  Fly    78 IAKNRIVRDCCDGYIASAGECVPHCSEPCQHGRCISPEKCKCDHGYGGPACDI------------ 130
            .:.|..||.....|     :.|.:.|......|.:.......|..:.||...:            
  Rat   342 QSNNNSVRATMHNY-----KLVLNRSLSISESRVLQLVVLVNDSDFQGPGSGVLFLHFNVSVLPV 401

  Fly   131 --NCPPGW-------YGRNCSMQCDCLNNAVCEPFSG------------DC-------------- 160
              |.|..:       ..|...:...|:.|  |:.|||            :|              
  Rat   402 TLNLPMAYSFPVNRRARRYAQIGKVCVEN--CQEFSGVSIQYKLQPSSTNCSALGVVTSTEDTSG 464

  Fly   161 -------------ECAKGYTGARCAD------------ICPEGFFGA---NCSEKC-------RC 190
                         ||.:........|            :..||.:.|   .|.:.|       .|
  Rat   465 TLYVNDTEALRRPECTELQYTVVATDRQTRRQTQASLVVTVEGTYIAEEVGCPKSCAVNKRRPEC 529

  Fly   191 ENGGKCHHVSGECQ---------------CAPGFTGPLCDMRCPDGKHGAQ-------CQQDC-- 231
            |..|.....:|.|:               |:|.      ...||||...|.       |.|||  
  Rat   530 EECGGLGSPTGRCEWRQGDGKGITRNFSTCSPS------TRTCPDGHCDALESRDINICPQDCLR 588

  Fly   232 -PC-------QNDG--------KCQPETGACMCNPGWTGDVCANKCPVGSYGPGCQESC 274
             |.       :..|        .|.|:...|.|.            |..|.||.|.|.|
  Rat   589 GPIVGGHERGERQGIKAGYGICNCFPDEKKCFCE------------PEDSQGPLCDELC 635

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877 19/78 (24%)
EGF_CA 274..319 CDD:304395 1/1 (100%)
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
RetNP_036775.2 Cadherin 173..248 CDD:278457
PTKc_RET 724..1013 CDD:173631
Pkinase_Tyr 725..1006 CDD:285015
Inhibitors binding. /evidence=ECO:0000250 806..808
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.