DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drpr and Dkk4

DIOPT Version :9

Sequence 1:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_663567.1 Gene:Dkk4 / 234130 MGIID:2385299 Length:221 Species:Mus musculus


Alignment Length:243 Identity:55/243 - (22%)
Similarity:72/243 - (29%) Gaps:101/243 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 GAKCA-ERICEANKYGLDCNRTCECDMEHTDLCHPETGNCQCSIGWSSAQCTRPCTFLRYGPNCE 403
            |:.|| :|.|...|:.|              ..|.|...|        |.|.|            
Mouse    38 GSLCASDRDCSEGKFCL--------------AFHDERSFC--------ATCRR------------ 68

  Fly   404 LTCNCKNGAKCSP----VNGTCLCAPGWRGPTCEESCEP----GTFGQDCALRCDC------QNG 454
            :...|:..|.|.|    ||..|         |..|...|    .|.|||.|.....      :|.
Mouse    69 VRRRCQRSAVCCPGTVCVNDVC---------TAVEDTRPVMDRNTDGQDGAYAEGTTKWPAEENR 124

  Fly   455 AKCEPETGQCLCTAGWKNIKCDRPCDLNHFGQDCAKVCDCHNNAACNPQNGSCTCAAGWT----- 514
            .:.:|.|.:...:.|.:             |:.|.:..|      |.|  |.|.....||     
Mouse   125 PQGKPSTKKSQSSKGQE-------------GESCLRTSD------CGP--GLCCARHFWTKICKP 168

  Fly   515 ----GERCERKCDTGKFGH-DCAQKCQ----CDFNNSLAC--DATNGR 551
                |:.|.|:      || |.||..:    ||....|.|  ..|:.|
Mouse   169 VLREGQVCSRR------GHKDTAQAPEIFQRCDCGPGLTCRSQVTSNR 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925 10/47 (21%)
DSL <567..606 CDD:302925
Dkk4NP_663567.1 Dickkopf_N 41..91 CDD:368068 19/92 (21%)
DKK-type Cys-1 41..90 18/82 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..143 9/54 (17%)
DKK-type Cys-2 145..218 22/80 (28%)
Prokineticin <145..202 CDD:148298 19/70 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.