DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drpr and FLT4

DIOPT Version :9

Sequence 1:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:XP_011532780.1 Gene:FLT4 / 2324 HGNCID:3767 Length:1440 Species:Homo sapiens


Alignment Length:132 Identity:33/132 - (25%)
Similarity:50/132 - (37%) Gaps:22/132 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   853 FDNPVYGMQAETRLLPNNMRSKMNNFDQRSTMSTDYGDDCNASGR-VGSYSINYNHDLLTKNLNA 916
            ||....|.|||........||:..:.:..|.::..     |.|.. :|||....|:.:.....:.
Human   341 FDWDYPGKQAERGKWVPERRSQQTHTELSSILTIH-----NVSQHDLGSYVCKANNGIQRFREST 400

  Fly   917 D---RTNPIVYNESLK----EEHVYDEIKHKEGYKDPVKIYSKILFPEDEYD-HLDYSRPSTSQK 973
            :   ..||.:..|.||    |....||:     .|.|||:.:   :|..|:. :.|....|....
Human   401 EVIVHENPFISVEWLKGPILEATAGDEL-----VKLPVKLAA---YPPPEFQWYKDGKALSGRHS 457

  Fly   974 PH 975
            ||
Human   458 PH 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
FLT4XP_011532780.1 Ig_2 215..301 CDD:290606
IG_like 315..404 CDD:214653 15/67 (22%)
Ig1_VEGFR 322..406 CDD:143270 15/69 (22%)
IG_like 420..492 CDD:214653 13/48 (27%)
Ig2_VEGFR-3 429..495 CDD:143271 10/34 (29%)
IG 641..734 CDD:214652
Ig 647..735 CDD:299845
I-set 755..842 CDD:254352
IGc2 770..832 CDD:197706
PTKc_VEGFR3 914..1253 CDD:270680
Pkinase_Tyr 922..1246 CDD:285015
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.