DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drpr and old-1

DIOPT Version :9

Sequence 1:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_496130.2 Gene:old-1 / 191737 WormBaseID:WBGene00003862 Length:502 Species:Caenorhabditis elegans


Alignment Length:230 Identity:44/230 - (19%)
Similarity:81/230 - (35%) Gaps:73/230 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   773 SGYTGDNCDELIASQRIADQSENS-----------------SRASVALTLVLMTLF---ACIIFA 817
            |.|...:|:.::.|..::...|:|                 |.....:.::|..||   |.:|..
 Worm    12 SSYGFAHCNTILRSSSLSRNFEDSLRRIPRSTDKDETGFEDSNVQEVIFILLYCLFVALAILICG 76

  Fly   818 VFIYYRRRVSNLK-------------TEIAHVHYTHDTNPPSWPPNHNFDNPVYGMQAETRLLPN 869
            :.|:|..|...|:             |...|.........|..|..:    |:...:::.|..| 
 Worm    77 LIIFYNSRKRELRANRSRGDEYLLEPTSADHKRRNSSNIVPPEPTPY----PITSGESDLRQTP- 136

  Fly   870 NMRSKMNNFD----------QRSTMSTDY-------GDDCNAS-GR---VGSYSINYNHDLLTKN 913
               |:::|.:          ....|...|       .:|.:.| ||   .|.:.|.....|.:||
 Worm   137 ---SRLSNVECPPELELAPINEKIMYLHYYAEVEINEEDLDISKGRPLGSGEFGIIRKGFLRSKN 198

  Fly   914 -LNADRTNPI---------VYNESLKEEHVYDEIK 938
             .|.::.:.:         .||: :::|.:|||:|
 Worm   199 SKNEEKESRLEVAVKLPLNEYNQ-IQQELIYDELK 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
old-1NP_496130.2 TyrKc 175..461 CDD:197581 16/59 (27%)
PTKc 179..462 CDD:270623 14/55 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.