DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drpr and ver-4

DIOPT Version :9

Sequence 1:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_509835.2 Gene:ver-4 / 186632 WormBaseID:WBGene00006897 Length:1216 Species:Caenorhabditis elegans


Alignment Length:257 Identity:50/257 - (19%)
Similarity:70/257 - (27%) Gaps:107/257 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   466 CTAGWKNIKCDRPCDLNHFGQDCAKVCDCHNNAACNPQNGSCTCAAG-----WTGERCERKCDTG 525
            |....||:|.:.|....|.|               .|:.|..|.|..     |...:..|:||||
 Worm    54 CYGQHKNLKIEPPKREEHAG---------------FPEIGIRTSAEWKKNEYWFLLKNVRQCDTG 103

  Fly   526 KFGHDCAQKCQCD-FNNSLACDAT--------------------NGRCV---CKQ----DWGGVH 562
            .:      .|..| |..|:..:..                    ||..:   ||.    |...|.
 Worm   104 SY------YCVSDEFKESMLQNTVHIFVRKLDIFVPLKTIYHEHNGSEIIIPCKTTKFVDTKNVE 162

  Fly   563 CETN------CRSGY---YGENCDK-------------VCRCLNN---------SSCDPDS---- 592
            ...|      ...||   ||....|             .|:..|:         |:.|||:    
 Worm   163 LYVNQVKLNSALQGYDQRYGFKLTKNMYTMKPNSTVFFECKYTNDSNQDLDYYISNSDPDATLID 227

  Fly   593 ---------------GN---CICSAGWTGADCAEPCPPGFYGMECKERCPEILHGNKSCDHI 636
                           ||   ..|...:.|:|...|.......:||.:...:..:.|:|...|
 Worm   228 QYFFYWEKSNDVPYVGNNYSITCHLVYIGSDSLRPLNHQEIVLECPQNQCDGGYNNQSAHEI 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925 7/43 (16%)
DSL <567..606 CDD:302925 15/85 (18%)
ver-4NP_509835.2 ig 609..679 CDD:278476
IG_like 611..692 CDD:214653
IG_like 709..782 CDD:214653
IGc2 714..772 CDD:197706
STYKc 870..1175 CDD:214568
PTKc 874..1176 CDD:270623
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.