Sequence 1: | NP_001261276.1 | Gene: | drpr / 38218 | FlyBaseID: | FBgn0027594 | Length: | 1042 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001076785.1 | Gene: | Pdgfra / 18595 | MGIID: | 97530 | Length: | 1089 | Species: | Mus musculus |
Alignment Length: | 262 | Identity: | 54/262 - (20%) |
---|---|---|---|
Similarity: | 85/262 - (32%) | Gaps: | 104/262 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 840 HDTN---------PPSW-PPNHNFDN------------------------PVYGMQAETRLLPNN 870
Fly 871 MRS--KMNNFDQRSTMSTDYGDDCNASGRVGSYSINYNHDLLTKNLNAD-RTNPIVYNESLKEEH 932
Fly 933 VYDEIKHKEGYKDPVKIYSKILFPEDEYDHLDYSRPSTSQKPHYHRM----NDAMLNINQ----- 988
Fly 989 ---------DEEKPSNVKNMTVLLNKPLPPTEPEPQHECFDNTNTNLDNVSTASP----SSSPKF 1040
Fly 1041 LK 1042 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
drpr | NP_001261276.1 | EMI | 27..92 | CDD:284877 | |
EGF_CA | 274..319 | CDD:304395 | |||
DSL | <479..518 | CDD:302925 | |||
DSL | <567..606 | CDD:302925 | |||
Pdgfra | NP_001076785.1 | Ig_3 | 28..100 | CDD:372822 | |
Ig_PDGFR-alphabeta | 228..311 | CDD:143269 | |||
Ig4_PDGFR | 313..413 | CDD:143267 | |||
Ig_TrkABC_d4 | 416..497 | CDD:143173 | |||
PTKc_PDGFR_alpha | 555..956 | CDD:173653 | 23/137 (17%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1018..1089 | 14/48 (29%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0200 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |