DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drpr and Pdgfra

DIOPT Version :9

Sequence 1:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_001076785.1 Gene:Pdgfra / 18595 MGIID:97530 Length:1089 Species:Mus musculus


Alignment Length:262 Identity:54/262 - (20%)
Similarity:85/262 - (32%) Gaps:104/262 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   840 HDTN---------PPSW-PPNHNFDN------------------------PVYGMQAETRLLPNN 870
            ||:|         |..| .|...|||                        |..||..::... |.
Mouse   845 HDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMMVDSTFY-NK 908

  Fly   871 MRS--KMNNFDQRSTMSTDYGDDCNASGRVGSYSINYNHDLLTKNLNAD-RTNPIVYNESLKEEH 932
            ::|  :|...|             :|:..|        ::::.:..|:: ...|..|:.|...|:
Mouse   909 IKSGYRMAKPD-------------HATSEV--------YEIMVQCWNSEPEKRPSFYHLSEIVEN 952

  Fly   933 VYDEIKHKEGYKDPVKIYSKILFPEDEYDHLDYSRPSTSQKPHYHRM----NDAMLNINQ----- 988
            :.     ...||   |.|.||        |||:.:   |..|...||    ::|.:.:..     
Mouse   953 LL-----PGQYK---KSYEKI--------HLDFLK---SDHPAVARMRVDSDNAYIGVTYKNEED 998

  Fly   989 ---------DEEKPSNVKNMTVLLNKPLPPTEPEPQHECFDNTNTNLDNVSTASP----SSSPKF 1040
                     ||::.|......:    |||..:|.|:.|.....|.:....|..|.    |||..|
Mouse   999 KLKDWEGGLDEQRLSADSGYII----PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTF 1059

  Fly  1041 LK 1042
            :|
Mouse  1060 IK 1061

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
PdgfraNP_001076785.1 Ig_3 28..100 CDD:372822
Ig_PDGFR-alphabeta 228..311 CDD:143269
Ig4_PDGFR 313..413 CDD:143267
Ig_TrkABC_d4 416..497 CDD:143173
PTKc_PDGFR_alpha 555..956 CDD:173653 23/137 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1018..1089 14/48 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.