DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drpr and F40G9.8

DIOPT Version :9

Sequence 1:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_001367839.1 Gene:F40G9.8 / 185556 WormBaseID:WBGene00018244 Length:273 Species:Caenorhabditis elegans


Alignment Length:227 Identity:51/227 - (22%)
Similarity:81/227 - (35%) Gaps:67/227 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   848 PPNHN-FDNPVYGMQAETRLLPNNMRSKMNNFDQRSTMSTDYGDDC----NASGRVGS-YSINYN 906
            ||:.: ||...|  ...|||             |.|..||....:.    ..|.:.|| .:.|||
 Worm    28 PPSFSIFDQEFY--TPGTRL-------------QISCSSTSTSPEALILETISRKFGSLVAANYN 77

  Fly   907 HDLLTKNLNADRTNPIVYNESLKEEHVYDEIK-HKEGYKDP-VKIYSKILFP------------- 956
                 |.::....:.:.||.||||:.   |:: .|.|.|.| :|:.:....|             
 Worm    78 -----KVVDGTFESGVFYNISLKEDL---EVRCWKVGKKIPSIKLINVADGPAKTFYEFEKSSHL 134

  Fly   957 -EDEYD----HLDYSRPSTSQKPHYHRMNDAMLNINQDEEKP---SNVKNMT-------VLLNKP 1006
             :..||    ||..|.|.::.......:.|..:|....|:..   |.::|::       |:....
 Worm   135 QKSAYDGDTVHLICSIPHSATNWEVSWLPDLPVNTRIHEKSKYFISTLRNISSYEVCTCVIKTDK 199

  Fly  1007 LPPTEPEPQHECFDNTNTNLDNVSTASPSSSP 1038
            ..|        .|..|..::...|.::||..|
 Worm   200 FEP--------MFLETVIDVKPASASAPSEMP 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
F40G9.8NP_001367839.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.