DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drpr and ver-3

DIOPT Version :9

Sequence 1:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_509836.1 Gene:ver-3 / 181289 WormBaseID:WBGene00006896 Length:1227 Species:Caenorhabditis elegans


Alignment Length:267 Identity:55/267 - (20%)
Similarity:93/267 - (34%) Gaps:88/267 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   768 GCVCR-SGYTGDNCDEL--IASQRIAD-------QSENSSRASVALTLVLMTLFACIIFAVFIY- 821
            |.:.| |...|::..|.  :|:.|..|       |..|:.:.|:.....|..|....|.|||:. 
 Worm   722 GSILRVSRARGEDDGEFHCLATNRAGDKLNSIEVQVNNAPKGSLFFYWFLALLLLISIIAVFLLT 786

  Fly   822 YRRRVSNLKTE--------IAHVHYTHDTNP-PS-------------WPPNHNFD---------N 855
            .:.|.||..|:        :......|...| |.             .|.|::::         |
 Worm   787 CKLRASNRLTKQKDIALNTLYETMIKHQAGPLPEEMKDLPVEERTYYLPYNNDYEIDPVNLEILN 851

  Fly   856 PV----YG---------------MQAETRLLPNNMRSKMN--NFDQRSTMSTDYGDDC------N 893
            |:    :|               ::::|| ||..::|..|  |.:.:..|:.:....|      |
 Worm   852 PIGSGHFGVVKKGLLGMAYPKSKIESKTR-LPVAVKSSTNPFNVELQKMMAEELKVMCAIPKNPN 915

  Fly   894 ASGRVGSYSINYNHDL------------LTKNLNADRTNPIVYNESLKEEHVYDEIKHKEGYKDP 946
            ....:|:.:.|.....            |.:.|.|.|...|  ||.:::|||..:    :.|..|
 Worm   916 VLALIGAVTKNMRQGQLYIVTEFIDGGNLREFLQAHRNTFI--NELVEDEHVPVD----DSYLVP 974

  Fly   947 VKIYSKI 953
            ..:..||
 Worm   975 NSVKKKI 981

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
ver-3NP_509836.1 IG 242..>313 CDD:214652
IG_like 578..667 CDD:214653
Ig_3 578..654 CDD:290638
I-set 673..757 CDD:254352 8/34 (24%)
IGc2 692..747 CDD:197706 7/24 (29%)
STYKc 847..1163 CDD:214568 29/142 (20%)
PTKc 851..1164 CDD:270623 29/138 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.