DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drpr and T25F10.3

DIOPT Version :9

Sequence 1:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_504708.1 Gene:T25F10.3 / 179067 WormBaseID:WBGene00020806 Length:429 Species:Caenorhabditis elegans


Alignment Length:261 Identity:62/261 - (23%)
Similarity:78/261 - (29%) Gaps:88/261 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   325 CDRANGTCICNP----GWTGAKCAERICEANKYGLDCNRTCECDMEHTDLCHPETGNCQCSIGWS 385
            |.|.......||    .||..        |:.|.:|....   ..|..|.|....|....     
 Worm    63 CCRRGSPVAENPQLVSNWTET--------ASDYAVDEKLV---GTEQDDHCRVFQGTFLL----- 111

  Fly   386 SAQCTRPCTFLRYGPNCELTCNCKNGAKCSPVNGTCLCAPGWRGPTCEESCEPGTFGQDCALRCD 450
            ||......||:.||..|          ||               |..|:.    ...|.|.....
 Worm   112 SAAALYNSTFVSYGVQC----------KC---------------PDAEQQ----QLDQHCRQLPA 147

  Fly   451 CQNGAKCEPETGQCLCTAGWKNIKCDRPCDLNHFGQDCAKVCDCHNNAACNPQNGSCTCAAGWTG 515
            ||||.......|        :...|.:|    :||:.|.|:||.....|....|..|:|...:.|
 Worm   148 CQNGGYRSQSIG--------RRCSCPQP----YFGEYCEKLCDQGQVLAGIDGNNYCSCLPFYQG 200

  Fly   516 ERC-ERKCDTGKFGHDCAQKCQCDFNNSLACDATNGRCVCKQDWGGVHCE-------TNCRSGYY 572
            |.| :..|..|  ||:                 ..|||.|..::.|.|||       :|.|...|
 Worm   201 ETCSDLVCLNG--GHE-----------------FRGRCSCPHNFVGYHCEIDTNKTKSNSRYTKY 246

  Fly   573 G 573
            |
 Worm   247 G 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925 12/38 (32%)
DSL <567..606 CDD:302925 3/7 (43%)
T25F10.3NP_504708.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24035
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.