DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drpr and cpg-24

DIOPT Version :10

Sequence 1:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_741322.2 Gene:cpg-24 / 176973 WormBaseID:WBGene00021525 Length:201 Species:Caenorhabditis elegans


Alignment Length:39 Identity:11/39 - (28%)
Similarity:16/39 - (41%) Gaps:16/39 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   501 NPQNGSCT----------------CAAGWTGERCERKCD 523
            ||..|:.:                |...||||:|:.:||
 Worm    95 NPARGASSPETLNLPLTGMMFEFKCQENWTGEKCDVRCD 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 26..92 CDD:462204
EGF_CA 274..319 CDD:473889
gliding_CglD <451..579 CDD:468178 11/39 (28%)
DSL 567..609 CDD:473190
cpg-24NP_741322.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.