Sequence 1: | NP_001261276.1 | Gene: | drpr / 38218 | FlyBaseID: | FBgn0027594 | Length: | 1042 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_498153.3 | Gene: | W03A5.1 / 175744 | WormBaseID: | WBGene00020966 | Length: | 803 | Species: | Caenorhabditis elegans |
Alignment Length: | 212 | Identity: | 39/212 - (18%) |
---|---|---|---|
Similarity: | 79/212 - (37%) | Gaps: | 73/212 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 858 YGMQAET------RLLPNNMR----SKMNNFDQRSTMSTDYGDDCNAS---GRVGSYSI---NYN 906
Fly 907 --HDLLTKNLNAD-----------RTNPIV------------YNESLKEEHV---------YDEI 937
Fly 938 KHKEGYKDPVKIYSKILFPEDEYDHLDYSRPSTSQKPHYHRMNDAMLNINQDEEK--PSNVKNMT 1000
Fly 1001 VLLNKPLPPTEPEPQHE 1017 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
drpr | NP_001261276.1 | EMI | 27..92 | CDD:284877 | |
EGF_CA | 274..319 | CDD:304395 | |||
DSL | <479..518 | CDD:302925 | |||
DSL | <567..606 | CDD:302925 | |||
W03A5.1 | NP_498153.3 | PTKc | 498..761 | CDD:270623 | |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0200 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |