DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drpr and Dkk3

DIOPT Version :9

Sequence 1:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_612528.2 Gene:Dkk3 / 171548 RGDID:621846 Length:348 Species:Rattus norvegicus


Alignment Length:219 Identity:49/219 - (22%)
Similarity:71/219 - (32%) Gaps:69/219 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 YRIKHRVVNKT--KTIAKNRIVRDCCDGYIASAGECVPHCSEPCQHGRCISPEKCKCDHGYGGPA 127
            :|..|::.|..  :|:....::....||             |..:...||..|.|       ||.
  Rat   112 HREVHKITNNQSGQTVFSETVITSVEDG-------------EGKKSHECIIDEDC-------GPT 156

  Fly   128 --CDIN-----CPPGWYGRNC-SMQCDCLNNAVCEPFSGDCECAKGYTGARCADICPEGFFGANC 184
              |..:     |.|      | ..|..|..::.|   .||..||.|:    |.....:|..|..|
  Rat   157 RYCQFSSFKYTCQP------CRDQQMLCTRDSEC---CGDQLCAWGH----CTQKATKGSNGTIC 208

  Fly   185 SEKCRCENGGKCHHVSGECQCAPGFTGPLCDMRCPDGK--HGAQCQ---------------QDCP 232
            ..:..|: .|.|      |....|...|:|.....:|:  |....|               ..||
  Rat   209 DNQRDCQ-PGLC------CAFQRGLLFPVCTPLPVEGELCHDPTSQMLDLITWELEPEGALDRCP 266

  Fly   233 CQNDGKCQPETGAC--MCNPGWTG 254
            |.:...|||.:.:.  ||.|.:.|
  Rat   267 CASGLLCQPHSHSLVYMCKPAFVG 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877 6/28 (21%)
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
Dkk3NP_612528.2 Dickkopf_N 147..196 CDD:282549 18/68 (26%)
Prokineticin <208..273 CDD:148298 14/71 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.