DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drpr and Kit

DIOPT Version :9

Sequence 1:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_001116205.1 Gene:Kit / 16590 MGIID:96677 Length:979 Species:Mus musculus


Alignment Length:204 Identity:42/204 - (20%)
Similarity:70/204 - (34%) Gaps:71/204 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   869 NNMRSKMN-------------------NFDQRSTM--STDYGDD-----CNASGRVGSYSINYNH 907
            |:|..|||                   |::::.|:  |:...||     |.|:...||.::....
Mouse   244 NSMWLKMNPQPQHIAQVKHNSWHRGDFNYERQETLTISSARVDDSGVFMCYANNTFGSANVTTTL 308

  Fly   908 DLLTK---NLNADRTNPIVYNESLKEEHVYDEIKHKEGYKDPVKIYSKILFPEDEYDHLDYSRPS 969
            .::.|   |::..:...:...:.   |:| |.:...|.|            |:.|:....|    
Mouse   309 KVVEKGFINISPVKNTTVFVTDG---ENV-DLVVEYEAY------------PKPEHQQWIY---- 353

  Fly   970 TSQKPHYHRMNDAMLNINQD---EEKPSNVKNMTVLLNKPLPPTEPEPQHECFDNTNTNLDNVST 1031
                     ||....|..:|   .:..||::.:..|....|..||        ..|.|.|  ||.
Mouse   354 ---------MNRTSANKGKDYVKSDNKSNIRYVNQLRLTRLKGTE--------GGTYTFL--VSN 399

  Fly  1032 ASPSSSPKF 1040
            :..|:|..|
Mouse   400 SDASASVTF 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
KitNP_001116205.1 ig 217..308 CDD:278476 14/63 (22%)
IG_like 221..310 CDD:214653 14/65 (22%)
Ig4_SCFR 314..414 CDD:143268 27/134 (20%)
IG_like 325..412 CDD:214653 26/123 (21%)
Ig 427..501 CDD:299845
PTKc_Kit 556..930 CDD:270682
Important for interaction with phosphotyrosine-binding proteins. /evidence=ECO:0000250 571..573
Pkinase_Tyr 592..926 CDD:285015
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.