Sequence 1: | NP_001261276.1 | Gene: | drpr / 38218 | FlyBaseID: | FBgn0027594 | Length: | 1042 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001116205.1 | Gene: | Kit / 16590 | MGIID: | 96677 | Length: | 979 | Species: | Mus musculus |
Alignment Length: | 204 | Identity: | 42/204 - (20%) |
---|---|---|---|
Similarity: | 70/204 - (34%) | Gaps: | 71/204 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 869 NNMRSKMN-------------------NFDQRSTM--STDYGDD-----CNASGRVGSYSINYNH 907
Fly 908 DLLTK---NLNADRTNPIVYNESLKEEHVYDEIKHKEGYKDPVKIYSKILFPEDEYDHLDYSRPS 969
Fly 970 TSQKPHYHRMNDAMLNINQD---EEKPSNVKNMTVLLNKPLPPTEPEPQHECFDNTNTNLDNVST 1031
Fly 1032 ASPSSSPKF 1040 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
drpr | NP_001261276.1 | EMI | 27..92 | CDD:284877 | |
EGF_CA | 274..319 | CDD:304395 | |||
DSL | <479..518 | CDD:302925 | |||
DSL | <567..606 | CDD:302925 | |||
Kit | NP_001116205.1 | ig | 217..308 | CDD:278476 | 14/63 (22%) |
IG_like | 221..310 | CDD:214653 | 14/65 (22%) | ||
Ig4_SCFR | 314..414 | CDD:143268 | 27/134 (20%) | ||
IG_like | 325..412 | CDD:214653 | 26/123 (21%) | ||
Ig | 427..501 | CDD:299845 | |||
PTKc_Kit | 556..930 | CDD:270682 | |||
Important for interaction with phosphotyrosine-binding proteins. /evidence=ECO:0000250 | 571..573 | ||||
Pkinase_Tyr | 592..926 | CDD:285015 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0200 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |