DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drpr and CCBE1

DIOPT Version :9

Sequence 1:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:XP_016881045.1 Gene:CCBE1 / 147372 HGNCID:29426 Length:435 Species:Homo sapiens


Alignment Length:215 Identity:48/215 - (22%)
Similarity:72/215 - (33%) Gaps:80/215 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 GSTWCVTFPPR------CSTYRI---KHRVVNKTKTIAKNRIVRDCCDGYIASAGECVPH----C 102
            |.||.....|.      ||..:|   |:..:..:..:. ....:.||.||....|:|:|.    |
Human    30 GHTWTYREEPEDGDREICSESKIATTKYPCLKSSGELT-TCYRKKCCKGYKFVLGQCIPEDYDVC 93

  Fly   103 SE-PCQHGRCISPEKCKCDHGYGGPACDINCPPGW-YGRNCSMQCDCLNNAVCEPFSGDCECAKG 165
            :| ||:.         :|...:|...|  .|.||: |.|....:.:       :|:         
Human    94 AEAPCEQ---------QCTDNFGRVLC--TCYPGYRYDRERHRKRE-------KPY--------- 131

  Fly   166 YTGARCADICPEGFFGANCSEKCRCENGGKCHHV------SGECQCAPGFTGPLCDMRCPDGKHG 224
                 |.||           ::|...||..|.|:      |..|:|..|:      :|..|||  
Human   132 -----CLDI-----------DECASSNGTLCAHICINTLGSYRCECREGY------IREDDGK-- 172

  Fly   225 AQCQQDCPCQNDGKCQPETG 244
                   .|....|...:||
Human   173 -------TCTRGDKYPNDTG 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877 11/49 (22%)
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
CCBE1XP_016881045.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.