DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drpr and Fgfr1

DIOPT Version :9

Sequence 1:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_034336.2 Gene:Fgfr1 / 14182 MGIID:95522 Length:822 Species:Mus musculus


Alignment Length:244 Identity:39/244 - (15%)
Similarity:74/244 - (30%) Gaps:83/244 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   839 THDTNP------PSWPPNHNFDNPVYGMQAETRL--------LPNNMRSKMNNFDQRSTMSTDYG 889
            |.:|.|      |.|......:..::.:.|...:        .||.....:.|           |
Mouse   141 TDNTKPNRRPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPSSGTPNPTLRWLKN-----------G 194

  Fly   890 DDCNASGRVGSYSINYNHDLLTKNLNADRTNP--------IVYNESLKEEHVYD-EIKHKEGYKD 945
            .:.....|:|.|.:.|    .|.::..|...|        ||.||.....|.|. ::..:..:: 
Mouse   195 KEFKPDHRIGGYKVRY----ATWSIIMDSVVPSDKGNYTCIVENEYGSINHTYQLDVVERSPHR- 254

  Fly   946 PV---------------------KIYSKILFPEDEYDHLDY--------SRPSTSQKPHYHRMND 981
            |:                     |:||      |...|:.:        |:......|:...:..
Mouse   255 PILQAGLPANKTVALGSNVEFMCKVYS------DPQPHIQWLKHIEVNGSKIGPDNLPYVQILKT 313

  Fly   982 AMLNINQDEEKPSNVKNMTVLLNKPLPPTEPEPQHECFDNTNTNLDNVS 1030
            |.:|....|.:..:::|::.         |...::.|....:..|.:.|
Mouse   314 AGVNTTDKEMEVLHLRNVSF---------EDAGEYTCLAGNSIGLSHHS 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
Fgfr1NP_034336.2 Ig1_FGFR 40..118 CDD:143174
IG_like 41..118 CDD:214653
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..162 5/20 (25%)
I-set 160..247 CDD:254352 18/101 (18%)
Heparin-binding 160..177 1/16 (6%)
Ig2_FGFR 163..247 CDD:143265 18/98 (18%)
IG_like 262..358 CDD:214653 15/107 (14%)
Ig3_FGFR 270..359 CDD:143175 15/99 (15%)
PTKc_FGFR1 464..765 CDD:270678
Pkinase_Tyr 478..754 CDD:285015
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 782..822
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.