Sequence 1: | NP_001261276.1 | Gene: | drpr / 38218 | FlyBaseID: | FBgn0027594 | Length: | 1042 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_034336.2 | Gene: | Fgfr1 / 14182 | MGIID: | 95522 | Length: | 822 | Species: | Mus musculus |
Alignment Length: | 244 | Identity: | 39/244 - (15%) |
---|---|---|---|
Similarity: | 74/244 - (30%) | Gaps: | 83/244 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 839 THDTNP------PSWPPNHNFDNPVYGMQAETRL--------LPNNMRSKMNNFDQRSTMSTDYG 889
Fly 890 DDCNASGRVGSYSINYNHDLLTKNLNADRTNP--------IVYNESLKEEHVYD-EIKHKEGYKD 945
Fly 946 PV---------------------KIYSKILFPEDEYDHLDY--------SRPSTSQKPHYHRMND 981
Fly 982 AMLNINQDEEKPSNVKNMTVLLNKPLPPTEPEPQHECFDNTNTNLDNVS 1030 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
drpr | NP_001261276.1 | EMI | 27..92 | CDD:284877 | |
EGF_CA | 274..319 | CDD:304395 | |||
DSL | <479..518 | CDD:302925 | |||
DSL | <567..606 | CDD:302925 | |||
Fgfr1 | NP_034336.2 | Ig1_FGFR | 40..118 | CDD:143174 | |
IG_like | 41..118 | CDD:214653 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 120..162 | 5/20 (25%) | |||
I-set | 160..247 | CDD:254352 | 18/101 (18%) | ||
Heparin-binding | 160..177 | 1/16 (6%) | |||
Ig2_FGFR | 163..247 | CDD:143265 | 18/98 (18%) | ||
IG_like | 262..358 | CDD:214653 | 15/107 (14%) | ||
Ig3_FGFR | 270..359 | CDD:143175 | 15/99 (15%) | ||
PTKc_FGFR1 | 464..765 | CDD:270678 | |||
Pkinase_Tyr | 478..754 | CDD:285015 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 782..822 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0200 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |