DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drpr and dkk3b

DIOPT Version :9

Sequence 1:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_001083014.1 Gene:dkk3b / 100038765 ZFINID:ZDB-GENE-061207-74 Length:283 Species:Danio rerio


Alignment Length:196 Identity:48/196 - (24%)
Similarity:61/196 - (31%) Gaps:59/196 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 RIKHRVVNKT------KTIAKN-----------RIVRDCCDG----YIASAGECVPHCSEPCQ-- 107
            ||..:..|||      :|:.:|           .|..||.||    |.....:||     |||  
Zfish   105 RINKKTDNKTGKTHFSRTLIQNTERWNEVDHECMIDEDCGDGSFCLYEIVTSKCV-----PCQTT 164

  Fly   108 HGRCISPEKCKCDHGYGGPACDINCPPGWYGRNCSMQCDCLNNAVCEPFSGDCECAKGYTGARCA 172
            :..|....:|..|.......|..|...|..|..|..|.||.....|           .:..|...
Zfish   165 NMECTKDVECCGDQLCVWGVCAQNKTKGQSGTICQNQNDCSPQHCC-----------AFHKALLF 218

  Fly   173 DIC-PEGFFGANCS-------EKCRCENGGKCHHVSGECQCAPGFTGPLCDM-----RCPDGKHG 224
            .:| |:...|..|.       |....|:.|...|    |.||.|.   ||..     .|.|.:|.
Zfish   219 PVCRPKPQEGQGCEREGNQLMEVLLWEDEGPREH----CPCAAGL---LCQQIQKSSVCVDERHA 276

  Fly   225 A 225
            :
Zfish   277 S 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877 12/46 (26%)
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
dkk3bNP_001083014.1 Dickkopf_N 137..186 CDD:282549 14/53 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.