DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drpr and fgfr4

DIOPT Version :9

Sequence 1:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_571505.1 Gene:fgfr4 / 100000160 ZFINID:ZDB-GENE-980526-488 Length:922 Species:Danio rerio


Alignment Length:57 Identity:17/57 - (29%)
Similarity:27/57 - (47%) Gaps:10/57 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   947 VKIYSKILFPEDEYDHLDYSRPSTSQKPHYHRMNDAMLNINQDEEKPSNVKNMTVLL 1003
            :|::..|.|.|     |..||..||.:|   |..|  :.:::....|...:|.|||:
Zfish     5 LKVFIAICFME-----LVCSRSITSGEP---RAKD--IRVSRHILTPGYPENATVLV 51

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
fgfr4NP_571505.1 IG_like 44..135 CDD:214653 4/8 (50%)
Ig 52..136 CDD:299845 17/57 (30%)
IG_like 150..224 CDD:214653
IGc2 156..212 CDD:197706
Ig2_FGFR 268..352 CDD:143265
IG_like 273..352 CDD:214653
IG_like 367..461 CDD:214653
Ig3_FGFR-2 375..462 CDD:143266
PTKc_FGFR4 565..877 CDD:133230
Pkinase_Tyr 578..854 CDD:285015
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.