DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18171 and CG14325

DIOPT Version :9

Sequence 1:NP_647651.1 Gene:CG18171 / 38216 FlyBaseID:FBgn0035262 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_650641.2 Gene:CG14325 / 42123 FlyBaseID:FBgn0038531 Length:460 Species:Drosophila melanogaster


Alignment Length:416 Identity:87/416 - (20%)
Similarity:152/416 - (36%) Gaps:94/416 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 SDDEDDSGNERRKRRH-----------ERNVARQRLRDLKAAREAEHEERRRRRSEMRKPKEPEP 313
            |:|::|..|:.:..||           |..:.||..|         .|:|....|.:......:.
  Fly    43 SEDQEDQTNQAKSLRHLVLDSIVENWSELPLYRQLGR---------REDRNYLLSHLDTQLPLQL 98

  Fly   314 RKKKKRR----QRIKGTFDIRVEPEPDDGDDK----VLDKRNKQRYLTHLQQLKYPEDDCVHIDL 370
            .....|.    ||..| ...|..|....|.::    :..:|:.|.::.::....|.:|..|.:.|
  Fly    99 LSAHIREDFFWQRCYG-HRWRSAPLQARGRERPWINIYMERHVQEFIENMPTGDYEQDGNVQVVL 162

  Fly   371 SFVRHFVNLVSLNLEFLGPA---------------------------------LGRKYHKRNVLF 402
            .....::|  .|.:.||.||                                 :|..|.......
  Fly   163 DICAAYIN--QLEISFLQPAPPTTDANDHIPLDYLLSNLPDLRQLRLSYSTKTVGCNYQMGCNQL 225

  Fly   403 SIKDMVRLARGLVALQQLQIFRLRNSRLNSFKLYTV-------CRALRLLPLLE--VVDFGYNQM 458
            :::|::.|.:||....:|:.|.|.|::|..::|..:       |..|..:.||.  |.|.|....
  Fly   226 TVRDILHLTKGLSQCHELRTFCLHNTKLMPYQLRFLAHSLDKGCHHLTEMSLLHCAVGDAGIRCF 290

  Fly   459 TDDCGPE-LGILLERPQMLKILELEYNRLDTRAMSAIGEALQR-PNLSRLEYLGLAHNKLSGDSL 521
            .:.||.| .|       .|.:|:|..|::.......:...|:. |    ||.|.|..|.:..|..
  Fly   291 LETCGKESFG-------TLTVLDLTNNKITEEGAYILSRTLRHVP----LEKLVLRLNPIQSDGA 344

  Fly   522 SILCNGIKGTEHVEELNVS--GIEANPRTIVDQLGDLLRHHDPLRRLIMVAIPLGAKLGTRLICA 584
            :.:.|.:: ...::||::.  ||   ..||......|:..|..|..:.:....||...|..|:..
  Fly   345 AAIFNTLQ-VMPIKELDLGTCGI---TETITKLFMMLICQHTSLLEIDLSNNSLGEDFGKHLMKI 405

  Fly   585 LTANMKVTHFDCRD--CDLDEQEEFE 608
            ::.|..:...|.|:  ..||.:.:|:
  Fly   406 ISCNKLLERLDLRNTGLSLDMRRKFQ 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18171NP_647651.1 LRR_RI <387..541 CDD:238064 41/199 (21%)
leucine-rich repeat 420..447 CDD:275380 8/33 (24%)
leucine-rich repeat 448..475 CDD:275380 8/29 (28%)
leucine-rich repeat 476..505 CDD:275380 6/29 (21%)
leucine-rich repeat 506..526 CDD:275380 6/19 (32%)
CG14325NP_650641.2 leucine-rich repeat 202..239 CDD:275380 6/36 (17%)
LRR_RI <206..440 CDD:238064 55/241 (23%)
leucine-rich repeat 240..271 CDD:275380 7/30 (23%)
leucine-rich repeat 272..301 CDD:275380 10/35 (29%)
leucine-rich repeat 302..326 CDD:275380 5/23 (22%)
leucine-rich repeat 329..353 CDD:275380 7/24 (29%)
leucine-rich repeat 356..383 CDD:275380 8/29 (28%)
leucine-rich repeat 384..407 CDD:275380 5/22 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.