DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18171 and Tcte1

DIOPT Version :9

Sequence 1:NP_647651.1 Gene:CG18171 / 38216 FlyBaseID:FBgn0035262 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_001101676.1 Gene:Tcte1 / 316242 RGDID:1305744 Length:498 Species:Rattus norvegicus


Alignment Length:561 Identity:101/561 - (18%)
Similarity:180/561 - (32%) Gaps:168/561 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 VPTLADLCVRQMAKRGNAN-VPDEVLQDPRKMRIHYDSLDVDLPLR-ECYCVEDASYWRRVVLAK 123
            ||.|.:||::.:.|....| :..::|.:.:|..:  .||..:|||. ....:||.:||.|..:.:
  Rat    74 VPLLTELCIQHIVKNFQNNPILKQLLPEHQKKVL--SSLPPELPLSVTANLIEDENYWHRCCIKR 136

  Fly   124 SSETCLALKGLQDYDWRGKGLSLKYMELVEACPAALWPEKEMTELAELIKDHVRCMDIRHLQPLS 188
            .|...::..|   ..|:..........|::...........:.:|..|.:::||.:.:....|  
  Rat   137 WSVCHVSKHG---DSWKRMFFERHLENLLKLFIPGTTDPNVILDLVPLCRNYVRRIHVDQFLP-- 196

  Fly   189 EYAFRKTKREEDDSEPEITSEESGGMEISSDEPM---TPEDVDEEGEEEEEGAGSIASDQKRAIG 250
                                            |:   ||...:|:.:...||.|:          
  Rat   197 --------------------------------PVRMPTPPQGEEQSDSGSEGEGN---------- 219

  Fly   251 FNTKFTLNASDDEDDSGNERRKRRHERNVARQRLRDLKAAREAEHEERRRRRSEMRKPKEPEPRK 315
                                                                         ||.|
  Rat   220 -------------------------------------------------------------EPEK 223

  Fly   316 KKKRRQRIKGTFDIRVEPEPDDGDDKVLDKRNKQRYLTHLQQLKYPEDDCVHIDLSFVRHFVNLV 380
            ...:.|.:.|..                      :||..| .|.|...||               
  Rat   224 NHYQLQALVGGL----------------------KYLEEL-DLVYGVKDC--------------- 250

  Fly   381 SLNLEFLGPALGRKYHKRNVLFSIKDMVRLARGLVALQQLQIFRLRNSRLNSFKLYTVCRALRLL 445
                       |..:.....||:.:|...||..:.|...|:||||..|:::..|...:.|:|...
  Rat   251 -----------GMNFEWNLFLFTYRDCHSLAATIKACHTLKIFRLTRSKVDDDKARILIRSLLDH 304

  Fly   446 PLLEVVDFGYNQMTDDCGPELGILLERPQMLKILELEYNRLDTRAMSAIGEALQRPNLSRLEYLG 510
            |.||.:|..:| :..|.|......|.....|::|.|..|:|......::..||  .:.:.|..|.
  Rat   305 PALEELDLSHN-LIGDRGARAAAKLLSHSRLRVLNLANNQLRASGAQSLAHAL--AHNTNLVSLN 366

  Fly   511 LAHNKLSGDSLSILCNGIKGTEHVEELNVSGIEANPRTIVDQLGDLLRHHDPLRRLIMVAIPLGA 575
            |..|.:..:....:.:.::..:.:..||:.|.|.:..| ...|..:|..:..|..|.:....:|.
  Rat   367 LRLNCIEDEGGQAIAHALETNKCLTVLNLGGNELSEPT-ATLLSQVLPVNTTLISLNLSCNHIGQ 430

  Fly   576 KLGTRLICALTANMKVTHFDCRDCDLDEQEEFEANVAVRRN 616
            ..|.:|:..::.|..:..||.|..|:.::.|:.....:..|
  Rat   431 DGGKQLLEGMSDNKTILEFDLRLSDVAQESEYLIGQVLHNN 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18171NP_647651.1 LRR_RI <387..541 CDD:238064 37/153 (24%)
leucine-rich repeat 420..447 CDD:275380 9/26 (35%)
leucine-rich repeat 448..475 CDD:275380 7/26 (27%)
leucine-rich repeat 476..505 CDD:275380 7/28 (25%)
leucine-rich repeat 506..526 CDD:275380 4/19 (21%)
Tcte1NP_001101676.1 LRR_RI 177..484 CDD:238064 78/453 (17%)
leucine-rich repeat 307..333 CDD:275380 7/26 (27%)
leucine-rich repeat 334..361 CDD:275380 7/28 (25%)
leucine-rich repeat 362..389 CDD:275380 4/26 (15%)
leucine-rich repeat 390..417 CDD:275380 7/27 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.