DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Slc22a14 and CG33233

DIOPT Version :9

Sequence 1:NP_001032838.1 Gene:Slc22a14 / 382113 MGIID:2685974 Length:629 Species:Mus musculus
Sequence 2:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster


Alignment Length:517 Identity:115/517 - (22%)
Similarity:192/517 - (37%) Gaps:159/517 - (30%)


- Green bases have known domain annotations that are detailed below.


Mouse   134 IPVPWDLDSIIHFGLNYTETCKFGWIYPFAHTRSLIN---------EFDLVCGNEPNKENGLTV- 188
            :.:.:.|..:|.|.:::       :||.::.|.|:..         |||    ..| ||..|.. 
  Fly    11 LTIGYGLGQVIIFMVSF-------FIYMYSVTESMTAGYLVVLTSCEFD----TSP-KEKTLLAN 63

Mouse   189 -FLSGVLTGSLLFGFLSDKLGRYPIILLSLLGFLIFGFGTAFVSSFYQYLFFRFF-------VAQ 245
             .|.|::...|..|||:|:.||..:|.|:|:|.|.|...:|.:...|.....|..       ||.
  Fly    64 SLLGGMVASGLFIGFLADRYGRKFVIRLALVGALSFSVISALMPDLYSLSVIRIIVGTFLSAVAS 128

Mouse   246 ASVGY--------------AICSVSLVMEWLVGEHRAQAVILQHSFLTIGVILLTGLAYKVVHWR 296
            ..||:              ||||.|..:..:.....|.| ||.::|   .|.|.:  :|.:..||
  Fly   129 LQVGFLGEFHAIKWRPITVAICSQSQGLALIYCPLVAMA-ILPNNF---NVDLSS--SYNLRVWR 187

Mouse   297 LLCLLGGMPMFPLICNIWVLRESPRWLMVRGKVEEAKKVLCYAAEVNKK---TIPLNLLNELQIS 358
            .|.:...:|.:..:..|.::.|:|.:||...:.::|...|.:...:|:|   .:.:.|..|    
  Fly   188 FLMMFFMIPGWLALVGICLVPETPHFLMSVNRPDKALLALKWICRMNRKKWEDVDITLSEE---- 248

Mouse   359 GKKVAKASILD--------------FCTNQHLFKVVLAIGCVWFTVSYISFTLNLKMNDFGLDVY 409
                 |:|..|              ..:..|:||..:.:    |.:..|.||      ..||.::
  Fly   249 -----KSSTNDQEGFWKTVWYEYKLLFSKPHVFKFFICL----FLIFGIFFT------SIGLGIW 298

Mouse   410 FVQMVRSIVAVPARLC----------------------------------------------CII 428
            |..:.....:...|||                                              |.|
  Fly   299 FPVIRNMDNSGSNRLCDLVNNNPTFINHEADDTNGTDSESPKCNDEMTNLIDPVYYGFTYIGCFI 363

Mouse   429 ----LLEYFGRKW--ALNLTLFLVTSMCLFLLFLPQEPKSTIILTLMLAEFSMAGTL-----SIF 482
                |:.:..||:  ||::.:.::..:.|.::..|     |::|...:....:.|.|     |:.
  Fly   364 LASVLVHWMTRKYVIALHILISMILGISLNIMKQP-----TVVLIFFVLMMVLPGVLIPLATSVL 423

Mouse   483 FIYTAELLPTVLRSTGLGMV-SLAWVAGAISS--VAIFKQTKTQLP--IFFCCL--CCVLAL 537
                .:.||..||...|.|| |||...|.:.|  :.:|.:....:.  ||..||  |.|||:
  Fly   424 ----VDCLPVNLRGKALCMVRSLARFGGVLGSTMIGLFIRVTCDVTFNIFNLCLAICVVLAV 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Slc22a14NP_001032838.1 2A0119 59..553 CDD:273328 115/517 (22%)
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 103/474 (22%)
MFS 23..>208 CDD:119392 52/202 (26%)
MFS 354..>482 CDD:304372 35/137 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843524
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.