DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13930 and CG10859

DIOPT Version :9

Sequence 1:NP_647645.1 Gene:CG13930 / 38210 FlyBaseID:FBgn0035256 Length:685 Species:Drosophila melanogaster
Sequence 2:NP_001285898.1 Gene:CG10859 / 34756 FlyBaseID:FBgn0032520 Length:627 Species:Drosophila melanogaster


Alignment Length:331 Identity:71/331 - (21%)
Similarity:117/331 - (35%) Gaps:67/331 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 YVWNIKNPVNPERRYHYQVPVVTVEFSPTQPQLLAIGLHNGGVEVRDISGQDLP----PLAVSQR 390
            |:||:.:...|...|..:..|...:........:..||..|.|.......|..|    ||....|
  Fly   216 YIWNLDDATRPAAHYDSRRVVRVAKVCLRDESYMVGGLQEGQVGFWLTENQGGPKSMCPLEACHR 280

  Fly   391 LSSPYFEPVTAIKWIYFEGDVGCRNPHITPFLATSQAGAVTKYRLINSPNMLGLEQQRLQRAEGE 455
                  |..|||.|::.:.:        |.|.:.|..|:: ||  .::.::|             
  Fly   281 ------EATTAICWVHSKLN--------TEFYSGSLDGSI-KY--WDTRDLL------------- 315

  Fly   456 LEGIPIERQPPAASLLANRHPQCLEIVLD-------------PVQSDIYYVLTDEGTLY---KCS 504
                     .|...:||...||.::...|             ||:   :...||.|.|:   :..
  Fly   316 ---------MPVHEVLAEPDPQTVQNRQDAHGVTFLEFEYTIPVR---FIFCTDMGYLFVGNRKG 368

  Fly   505 TNYPLQHLELRQVHDGPAACMEFSPWSPRMYLTCGSDWCIRIWLAGIL-LPIVTLQHHLSPVHCA 568
            |......:...|:..||..|:..:|:..:.:|..| ||.:|||...:. .|........:.:...
  Fly   369 TTPQDTIVAAYQLFAGPIRCVMRNPFFVKNFLVVG-DWRVRIWSEEVKNCPSTFYFRRPNQLLSG 432

  Fly   569 RWSRTH-STILVSLSRSTVDIWDLRNSTMKPVSSTVIDADIFYTTFKFTHCGRSLAVGNEAGNLL 632
            .||... |...:..:...::.|||..|..:|:.:......:.:..||  ..|..|.|....|:.|
  Fly   433 AWSTGRCSLFCIGDNMGNLEFWDLLMSHKRPILTIKYKYAVTHLVFK--PDGTMLTVSLANGDCL 495

  Fly   633 MLSFED 638
            ||..|:
  Fly   496 MLRLEE 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13930NP_647645.1 WD40 <279..648 CDD:225201 71/331 (21%)
WD40 repeat 295..344 CDD:293791 4/13 (31%)
WD40 repeat 350..397 CDD:293791 10/50 (20%)
WD40 repeat 400..473 CDD:293791 13/72 (18%)
WD40 repeat 478..513 CDD:293791 8/50 (16%)
WD40 <518..>593 CDD:295369 18/76 (24%)
WD40 repeat 524..560 CDD:293791 10/36 (28%)
CG10859NP_001285898.1 WD40 <245..310 CDD:295369 20/81 (25%)
WD40 261..>512 CDD:225201 61/286 (21%)
WD40 279..492 CDD:295369 52/257 (20%)
WD40 repeat 284..332 CDD:293791 16/80 (20%)
WD40 repeat 386..422 CDD:293791 10/36 (28%)
WD40 repeat 429..454 CDD:293791 3/24 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435273
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1587
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12442
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.