DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13930 and SdicB

DIOPT Version :9

Sequence 1:NP_647645.1 Gene:CG13930 / 38210 FlyBaseID:FBgn0035256 Length:685 Species:Drosophila melanogaster
Sequence 2:NP_001303577.1 Gene:SdicB / 26067075 FlyBaseID:FBgn0283433 Length:533 Species:Drosophila melanogaster


Alignment Length:352 Identity:81/352 - (23%)
Similarity:147/352 - (41%) Gaps:52/352 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   313 GVYSHGKVSKLPRSGWVYVWNIK-NPVNPERRYHYQVPVVTVEFSPTQPQLLAIGLHNGGVEVRD 376
            |.|.:.:.|.....|.|.|||.| ....||..:|.|..|::..|:...|.|:..|.::|.:.:.|
  Fly   211 GSYHNNEESPNEPDGVVMVWNTKFKKSTPEDVFHCQSAVMSTCFAKFNPNLILGGTYSGQIVLWD 275

  Fly   377 ISGQDLPPLAVSQRLSSPYFEPVTAIKWIYFEGDVGCRNPHITPFLATSQAGAVTKYRLINSPNM 441
            ...|...|:..:...::.:..||..::.      ||.:|.|  ..::.|..|.:..:.|    :|
  Fly   276 NRVQKRTPIQRTPLSAAAHTHPVYCLQM------VGTQNAH--NVISISSDGKLCSWSL----DM 328

  Fly   442 LGLEQQRLQRAEGELEGIPIERQPPAASLLANRHP--QCLEIVLDPVQSDIYYVLTDEGTLYKCS 504
            |...|..|     ||:    :||..|.::.:...|  :...:|:.          :::|.:|..|
  Fly   329 LSQPQDTL-----ELQ----QRQSKAIAITSMAFPANEINSLVMG----------SEDGYVYSAS 374

  Fly   505 TNYPLQH------LELRQVHDGPAACM-----EFSPWSPRMYLTCGSDWCIRIWLAGILLPIVTL 558
                 :|      .|:.:.|.||...:     :.||....::||...||.|::|......|:.:.
  Fly   375 -----RHGLRSGVNEVYERHLGPITGISTHYNQLSPDFGHLFLTSSIDWTIKLWSLKDTKPLYSF 434

  Fly   559 QHHLSPVHCARWSRTHSTILVSLSRS-TVDIWDLRNSTMKPVSSTVIDADIFYTTFKFTHCGRSL 622
            :.:...|....||..|..:..::..| .:|:|:|...|..|::|.|:..........:|..|..:
  Fly   435 EDNSDYVMDVAWSPVHPALFAAVDGSGRLDLWNLNQDTEVPIASIVVAGAPALNRVSWTPSGLHV 499

  Fly   623 AVGNEAGNLLMLSF-EDMPFPPHFQYK 648
            .:|:|||.|.:... |::..|...:.|
  Fly   500 CIGDEAGKLYVYDVAENLAQPSRDEIK 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13930NP_647645.1 WD40 <279..648 CDD:225201 80/350 (23%)
WD40 repeat 295..344 CDD:293791 11/31 (35%)
WD40 repeat 350..397 CDD:293791 9/46 (20%)
WD40 repeat 400..473 CDD:293791 16/72 (22%)
WD40 repeat 478..513 CDD:293791 5/40 (13%)
WD40 <518..>593 CDD:295369 20/80 (25%)
WD40 repeat 524..560 CDD:293791 9/40 (23%)
SdicBNP_001303577.1 Dynein_IC2 23..51 CDD:288403
NtpH 108..>178 CDD:225368
WD40 196..512 CDD:295369 78/336 (23%)
WD40 repeat 196..245 CDD:293791 11/33 (33%)
WD40 <224..523 CDD:225201 77/334 (23%)
WD40 repeat 251..289 CDD:293791 8/37 (22%)
WD40 repeat 298..337 CDD:293791 12/55 (22%)
WD40 repeat 349..435 CDD:293791 19/100 (19%)
WD40 repeat 441..479 CDD:293791 10/37 (27%)
WD40 repeat 487..513 CDD:293791 7/25 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435309
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12442
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.