DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG13930 and prp-17

DIOPT Version :9

Sequence 1:	NP_647645.1	Gene:	CG13930 / 38210	FlyBaseID:	FBgn0035256	Length:	685	Species:	Drosophila melanogaster
Sequence 2:	NP_492851.1	Gene:	prp-17 / 172999	WormBaseID:	WBGene00018625	Length:	567	Species:	Caenorhabditis elegans

Alignment Length:	81	Identity:	18/81 - (22%)
Similarity:	34/81 - (41%)	Gaps:	1/81 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly   518 HDGPAACMEFSPWSPRMYLTCGSDWCIRIWLAGILLPIV-TLQHHLSPVHCARWSRTHSTILVSL 581
            |:.....:::.|.|..::|:|..|..|::|.......:| |...|..||....::...:..|.:.
Worm   274 HNKGVNFLQWFPKSAHLFLSCSMDTKIKLWEVYDRQRVVRTYAGHKLPVREVAFNNEGTEFLSAS 338

  Fly   582 SRSTVDIWDLRNSTMK 597
            ....|.:||.....:|
Worm   339 FDRYVKLWDTETGQVK 354

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG13930	NP_647645.1	WD40	<279..648	CDD:225201	18/81 (22%)
		WD40 repeat	295..344	CDD:293791
		WD40 repeat	350..397	CDD:293791
		WD40 repeat	400..473	CDD:293791
		WD40 repeat	478..513	CDD:293791
		WD40	<518..>593	CDD:295369	17/75 (23%)
		WD40 repeat	524..560	CDD:293791	9/36 (25%)
prp-17	NP_492851.1	WD40	267..567	CDD:238121	18/81 (22%)
		WD40 repeat	279..317	CDD:293791	9/37 (24%)
		WD40 repeat	322..359	CDD:293791	6/33 (18%)
		WD40 repeat	364..402	CDD:293791
		WD40 repeat	408..443	CDD:293791
		WD40 repeat	451..491	CDD:293791
		WD40 repeat	500..523	CDD:293791
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910