DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX5 and RAB36

DIOPT Version :9

Sequence 1:NP_647644.2 Gene:RabX5 / 38209 FlyBaseID:FBgn0035255 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_006724444.1 Gene:RAB36 / 9609 HGNCID:9775 Length:370 Species:Homo sapiens


Alignment Length:219 Identity:86/219 - (39%)
Similarity:121/219 - (55%) Gaps:21/219 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLPQPPTVVLHDPRTHLRHLPPAYSAAQTPLSKERDFGAQVRYYL-EAPRKPK------------ 61
            |||.|.......|......:..:.:....|:|::|...:..::|. ||..:.:            
Human    72 LLPLPELCHASQPSKDCGRMRSSLTPLGPPVSRDRVIASFPKWYTPEACLQLREHFHGQVSAACQ 136

  Fly    62 --------FRPCKVIFVGDCSVGKTAIVNRFCYDKFQSNYKATIGVDFELENFSILGHNYSLEMW 118
                    .:..||:.|||..||||::::|||.:.|..:||||||||||:|.|.|.|..|||::|
Human   137 RRNTGTVGLKLSKVVVVGDLYVGKTSLIHRFCKNVFDRDYKATIGVDFEIERFEIAGIPYSLQIW 201

  Fly   119 DTAGQERFRCIAGAYYRNASVIVVTYDMSKKDSLESAKKWLNSALNYNASKRPLVFLVGTKADLL 183
            ||||||:|:|||.||||.|.||:..:|::...:||..::||..||..|.:....:||||||.|||
Human   202 DTAGQEKFKCIASAYYRGAQVIITAFDLTDVQTLEHTRQWLEDALRENEAGSCFIFLVGTKKDLL 266

  Fly   184 SKEEFVRMERLAGLAAAELQAEYW 207
            |.....:.|..|...|.|:|||||
Human   267 SGAACEQAEADAVHLAREMQAEYW 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX5NP_647644.2 P-loop_NTPase 66..230 CDD:304359 75/142 (53%)
RAB 66..225 CDD:197555 75/142 (53%)
RAB36XP_006724444.1 P-loop_NTPase 148..290 CDD:304359 73/141 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152436
Domainoid 1 1.000 177 1.000 Domainoid score I3604
eggNOG 1 0.900 - - E1_KOG0094
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3610
Inparanoid 1 1.050 190 1.000 Inparanoid score I3888
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48903
OrthoDB 1 1.010 - - D1048146at2759
OrthoFinder 1 1.000 - - FOG0003705
OrthoInspector 1 1.000 - - otm40629
orthoMCL 1 0.900 - - OOG6_106322
Panther 1 1.100 - - O PTHR47977
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8208
SonicParanoid 1 1.000 - - X2570
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.