DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX5 and TEM1

DIOPT Version :9

Sequence 1:NP_647644.2 Gene:RabX5 / 38209 FlyBaseID:FBgn0035255 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_013647.1 Gene:TEM1 / 854938 SGDID:S000004529 Length:245 Species:Saccharomyces cerevisiae


Alignment Length:164 Identity:47/164 - (28%)
Similarity:75/164 - (45%) Gaps:20/164 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 KVIFVGDCSVGKTAIVNRFCYDKFQSNYKATIGVDFELENFSILGHNYSLEMWDTAGQERFRCIA 130
            :|..|||..||||:::.::..:.:...|..|:||:|.....||...:....:.|..||..|..:.
Yeast    22 QVGLVGDAQVGKTSLMVKYVQNIYDKEYTQTLGVNFLKRKVSIRSTDIIFSIMDLGGQREFINML 86

  Fly   131 GAYYRNASVIVVTYDMSKKDSLESAKKWLNSALNYNASKRPLVFLVGTKADLLSKEEFVRMERLA 195
            ......:|||:..:|:::.::|.|.|:|...|...|.|..|:  |||||.|||            
Yeast    87 PIATVGSSVIIFLFDLTRPETLSSIKEWYRQAYGLNDSAIPI--LVGTKYDLL------------ 137

  Fly   196 GLAAAELQAEYWSVSARSGFKVTELFQRIAALAF 229
                .:|..||....:|:..|..::..  |.|.|
Yeast   138 ----IDLDPEYQEQISRTSMKYAQVMN--APLIF 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX5NP_647644.2 P-loop_NTPase 66..230 CDD:304359 47/164 (29%)
RAB 66..225 CDD:197555 44/158 (28%)
TEM1NP_013647.1 Spg1 21..202 CDD:206701 47/164 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.