DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX5 and YPT6

DIOPT Version :9

Sequence 1:NP_647644.2 Gene:RabX5 / 38209 FlyBaseID:FBgn0035255 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_013363.1 Gene:YPT6 / 850966 SGDID:S000004252 Length:215 Species:Saccharomyces cerevisiae


Alignment Length:220 Identity:71/220 - (32%)
Similarity:120/220 - (54%) Gaps:24/220 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 KVIFVGDCSVGKTAIVNRFCYDKFQSNYKATIGVDFELENFSILGHNYSLEMWDTAGQERFRCIA 130
            |::|:|:..||||:::.||.||.|..:|:||||:||..:...:......|::||||||||||.:.
Yeast    12 KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDDKTIRLQLWDTAGQERFRSLI 76

  Fly   131 GAYYRNASVIVVTYDMSKKDSLESAKKWLNSALNYNASKRPLVFLVGTKADL-----LSKEEFVR 190
            .:|.|::.|.::.||::|:.|.|...||:....|....:..::.:||.|:||     :|.||   
Yeast    77 PSYIRDSRVAIIVYDITKRKSFEYIDKWIEDVKNERGDENVILCIVGNKSDLSDERQISTEE--- 138

  Fly   191 MERLAGLAAAELQAEYWSVSARSGFKVTELFQRIAALAFEEAVMQEIRSIKNKP--QEQATQASV 253
            .|:.|.|..|::   :...|.::|:.|..||::||      ..:.|.::.::.|  .|.|..|:.
Yeast   139 GEKKAKLLGAKI---FMETSTKAGYNVKALFKKIA------KSLPEFQNSESTPLDSENANSANQ 194

  Fly   254 -KSQTFDLRNFFGSRLSQQKSGCTC 277
             |....|:    .:...|::|.|.|
Yeast   195 NKPGVIDI----STAEEQEQSACQC 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX5NP_647644.2 P-loop_NTPase 66..230 CDD:304359 60/168 (36%)
RAB 66..225 CDD:197555 58/163 (36%)
YPT6NP_013363.1 Rab6 11..173 CDD:206654 60/172 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0094
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.