DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX5 and RAB34

DIOPT Version :9

Sequence 1:NP_647644.2 Gene:RabX5 / 38209 FlyBaseID:FBgn0035255 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_024306736.1 Gene:RAB34 / 83871 HGNCID:16519 Length:408 Species:Homo sapiens


Alignment Length:210 Identity:68/210 - (32%)
Similarity:93/210 - (44%) Gaps:62/210 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 HLPPAYSAAQTPLSKERDFGAQVRYYLEAPRKPKFRPCKVIFVGDCSVGKTAIVNRFCYDKFQSN 92
            |.|.:|     |.|             .||..||...|..:|:.                     
Human   227 HTPSSY-----PFS-------------PAPTPPKIHTCASLFLP--------------------- 252

  Fly    93 YKATIGVDFELENFSILGHNYSLEMWDTAGQERFRCIAGAYYRNASVIVVTYDMSKKDSLESAKK 157
                                   ..|||||||||:|||..|||.|..|::.::::...|||..|:
Human   253 -----------------------SSWDTAGQERFKCIASTYYRGAQAIIIVFNLNDVASLEHTKQ 294

  Fly   158 WLNSALNYNASKRPLVFLVGTKADLLSKEEFVRMERLAGLAAAELQAEYWSVSARSGFKVTELFQ 222
            ||..||..|.....|:||||:|.||.:..::..||:.|...|.|::||||:||:.:|..|.|.|.
Human   295 WLADALKENDPSSVLLFLVGSKKDLSTPAQYALMEKDALQVAQEMKAEYWAVSSLTGENVREFFF 359

  Fly   223 RIAALAFEEAVMQEI 237
            |:|||.||..|:.|:
Human   360 RVAALTFEANVLAEL 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX5NP_647644.2 P-loop_NTPase 66..230 CDD:304359 54/163 (33%)
RAB 66..225 CDD:197555 51/158 (32%)
RAB34XP_024306736.1 DNA_pol3_gamma3 <3..>171 CDD:331207
P-loop_NTPase <255..369 CDD:328724 55/113 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 177 1.000 Domainoid score I3604
eggNOG 1 0.900 - - E1_KOG0094
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 190 1.000 Inparanoid score I3888
Isobase 1 0.950 - 0 Normalized mean entropy S1510
OMA 1 1.010 - - QHG48903
OrthoDB 1 1.010 - - D1048146at2759
OrthoFinder 1 1.000 - - FOG0003705
OrthoInspector 1 1.000 - - otm40629
orthoMCL 1 0.900 - - OOG6_106322
Panther 1 1.100 - - LDO PTHR47977
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8208
SonicParanoid 1 1.000 - - X2570
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1413.860

Return to query results.
Submit another query.