DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX5 and RA-5

DIOPT Version :9

Sequence 1:NP_647644.2 Gene:RabX5 / 38209 FlyBaseID:FBgn0035255 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_171715.1 Gene:RA-5 / 837023 AraportID:AT1G02130 Length:203 Species:Arabidopsis thaliana


Alignment Length:210 Identity:69/210 - (32%)
Similarity:109/210 - (51%) Gaps:19/210 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 KVIFVGDCSVGKTAIVNRFCYDKFQSNYKATIGVDFELENFSILGHNYSLEMWDTAGQERFRCIA 130
            |::.:||..|||:.::.||..|.:..:|.:||||||::......|....|::||||||||||.|.
plant    10 KLLLIGDSGVGKSCLLLRFSDDSYVESYISTIGVDFKIRTVEQDGKTIKLQIWDTAGQERFRTIT 74

  Fly   131 GAYYRNASVIVVTYDMSKKDSLESAKKWLNSALNYNASKRPLVFLVGTKADLLSKEEFVRMERLA 195
            .:|||.|..|::.||::.::|..:.|:||:....| ||......|||.|:| |::...:..| .|
plant    75 SSYYRGAHGIIIVYDVTDEESFNNVKQWLSEIDRY-ASDNVNKLLVGNKSD-LTENRAIPYE-TA 136

  Fly   196 GLAAAELQAEYWSVSARSGFKVTELFQRIAALAFEEAVMQEIRSIKNKPQEQATQASVKSQTFDL 260
            ...|.|:...:...||:....|.:.|..::|            |||.:...|....:.:..|..:
plant   137 KAFADEIGIPFMETSAKDATNVEQAFMAMSA------------SIKERMASQPAGNNARPPTVQI 189

  Fly   261 RNFFGSRLSQQKSGC 275
            |   |..:: ||:||
plant   190 R---GQPVA-QKNGC 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX5NP_647644.2 P-loop_NTPase 66..230 CDD:304359 58/163 (36%)
RAB 66..225 CDD:197555 57/158 (36%)
RA-5NP_171715.1 Rab1_Ypt1 7..172 CDD:206661 61/176 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.