DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX5 and rab36

DIOPT Version :9

Sequence 1:NP_647644.2 Gene:RabX5 / 38209 FlyBaseID:FBgn0035255 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_004910645.2 Gene:rab36 / 733793 XenbaseID:XB-GENE-490801 Length:264 Species:Xenopus tropicalis


Alignment Length:240 Identity:100/240 - (41%)
Similarity:144/240 - (60%) Gaps:21/240 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RLRQNLLLPQPPTVVLHDPRTHLRHLPPAYSAAQTPLSKERDFGAQVRYYLEAPRKPKFRPCKVI 68
            |:..|:..|..|. ..|..:|.       :.|....:.::|:.||           ...:..|.:
 Frog    13 RIISNMPKPYTPE-ACHQYQTQ-------FDAEVQTVCQQRNAGA-----------IGLKMSKAV 58

  Fly    69 FVGDCSVGKTAIVNRFCYDKFQSNYKATIGVDFELENFSILGHNYSLEMWDTAGQERFRCIAGAY 133
            .|||..||||:::||||.:.|..:||||||||||:|.|.|||..::.::|||||||:|:|||.||
 Frog    59 MVGDLYVGKTSLINRFCKNVFDRDYKATIGVDFEIERFEILGIPFNFQIWDTAGQEKFKCIASAY 123

  Fly   134 YRNASVIVVTYDMSKKDSLESAKKWLNSALNYNASKRPLVFLVGTKADLLSKEEFVRMERLAGLA 198
            ||.|.||:..:|:....:||:.::|:..||..|......:||||||.|.||:.|..|.|:.|...
 Frog   124 YRGAQVIITAFDLGDISTLENTRRWVQDALKENEPDTCSIFLVGTKKDTLSEAELERTEQDAVRL 188

  Fly   199 AAELQAEYWSVSARSGFKVTELFQRIAALAFEEAVMQEIRSIKNK 243
            |.:||||||||||::|..|.|.|.|:|:||||:::.:|:.  ||:
 Frog   189 AIDLQAEYWSVSAKTGENVKEFFFRVASLAFEQSMKKELE--KNR 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX5NP_647644.2 P-loop_NTPase 66..230 CDD:304359 85/163 (52%)
RAB 66..225 CDD:197555 82/158 (52%)
rab36XP_004910645.2 P-loop_NTPase 55..220 CDD:422963 85/164 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 184 1.000 Domainoid score I3351
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3610
Inparanoid 1 1.050 196 1.000 Inparanoid score I3699
OMA 1 1.010 - - QHG48903
OrthoDB 1 1.010 - - D1048146at2759
OrthoFinder 1 1.000 - - FOG0003705
OrthoInspector 1 1.000 - - otm47808
Panther 1 1.100 - - O PTHR47977
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2570
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.