DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX5 and rab6ba

DIOPT Version :9

Sequence 1:NP_647644.2 Gene:RabX5 / 38209 FlyBaseID:FBgn0035255 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_005165989.1 Gene:rab6ba / 558900 ZFINID:ZDB-GENE-050809-136 Length:258 Species:Danio rerio


Alignment Length:291 Identity:89/291 - (30%)
Similarity:137/291 - (47%) Gaps:65/291 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PTVVLHDPRTHLR--------------HLPPAYSAAQTPLSKER--------DFGAQVRYYLEAP 57
            |..:..||..|.|              | |..|:...|.|::.:        |||..:|      
Zfish     5 PFSLTADPVQHSRLQTHRSAAFSIALPH-PNIYTGGNTLLNQNKPSNMSVGNDFGNPLR------ 62

  Fly    58 RKPKFRPCKVIFVGDCSVGKTAIVNRFCYDKFQSNYKATIGVDFELENFSILGHNYSLEMWDTAG 122
               ||   |::|:|:.|||||:::.||.||.|.:.|:||||:||..:...:......|::|||||
Zfish    63 ---KF---KLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAG 121

  Fly   123 QERFRCIAGAYYRNASVIVVTYDMSKKDSLESAKKWLNSALNYNASKRPLVFLVGTKADLLSKEE 187
            |||||.:..:|.|:::|.||.||::..:|.:...||::.......|. .::.|||.|.||..|.:
Zfish   122 QERFRSLIPSYIRDSTVAVVVYDITNVNSFQQTSKWIDDVRTERGSD-VIIMLVGNKTDLADKRQ 185

  Fly   188 FVRMERLAGLAAAELQAEYWSVSARSGFKVTELFQRIAAL-----AFEEAVMQEIRSIK-NKPQE 246
            ....|  ....|.||...:...||::|:.|.:||:|:||.     :.:|...:.:..|| :||||
Zfish   186 ITIEE--GEQRAKELSVMFIETSAKTGYNVKQLFRRVAAALPGMESMQETSKEGMIDIKLDKPQE 248

  Fly   247 QATQASVKSQTFDLRNFFGSRLSQQKSGCTC 277
            ..|                     .:.||:|
Zfish   249 PPT---------------------TEGGCSC 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX5NP_647644.2 P-loop_NTPase 66..230 CDD:304359 62/168 (37%)
RAB 66..225 CDD:197555 60/158 (38%)
rab6baXP_005165989.1 Rab6 64..224 CDD:206654 63/165 (38%)
RAB 64..221 CDD:197555 61/162 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0094
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.