DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX5 and rab34

DIOPT Version :9

Sequence 1:NP_647644.2 Gene:RabX5 / 38209 FlyBaseID:FBgn0035255 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001006769.1 Gene:rab34 / 448455 XenbaseID:XB-GENE-494108 Length:259 Species:Xenopus tropicalis


Alignment Length:263 Identity:108/263 - (41%)
Similarity:149/263 - (56%) Gaps:24/263 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LRQNLLLPQPPTVVLHDPRTHLRHLPPAYSAAQTPLSKERDFGAQVRYYLEAPRKPKFRPCKVIF 69
            :|::.::.:.|.....:...|.|.   ::.:..|...|::..|. |.|.:.          |||.
 Frog     7 VRRDRIVAELPQCFRKEACLHTRE---SFHSKVTSACKQQRTGT-VGYKIS----------KVIV 57

  Fly    70 VGDCSVGKTAIVNRFCYDKFQSNYKATIGVDFELENFSILGHNYSLEMWDTAGQERFRCIAGAYY 134
            |||.|||||.::||||.|.|..|||||||||||:|.|.|||..:||::|||||||||:|||..||
 Frog    58 VGDLSVGKTCLINRFCKDTFDKNYKATIGVDFEMERFEILGVPFSLQLWDTAGQERFKCIASTYY 122

  Fly   135 RNASVIVVTYDMSKKDSLESAKKWLNSALNYNASKRPLVFLVGTKADLLSKEEFVRMERLAGLAA 199
            |.|..|::.:|::...|||..|:||..||..|.....|:||||:|.||....::..||:.|...|
 Frog   123 RGAQAIIIAFDLTDVSSLEHTKQWLQDALKENDPSSALLFLVGSKKDLSPPAQYALMEKDAIKVA 187

  Fly   200 AELQAEYWSVSARSGFKVTELFQRIAALAFEEAVMQEIRSIK----------NKPQEQATQASVK 254
            .|:||||||||:.:|..|.|.|.|:|:|.||.:|:.|:....          |.......|.|.|
 Frog   188 KEMQAEYWSVSSLTGENVKEFFFRVASLTFESSVLAELEKTNARRIGEVVRINSNDRNLYQCSKK 252

  Fly   255 SQT 257
            ::|
 Frog   253 NKT 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX5NP_647644.2 P-loop_NTPase 66..230 CDD:304359 90/163 (55%)
RAB 66..225 CDD:197555 88/158 (56%)
rab34NP_001006769.1 Rab36_Rab34 53..219 CDD:206693 91/175 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 184 1.000 Domainoid score I3351
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 196 1.000 Inparanoid score I3699
OMA 1 1.010 - - QHG48903
OrthoDB 1 1.010 - - D1048146at2759
OrthoFinder 1 1.000 - - FOG0003705
OrthoInspector 1 1.000 - - otm47808
Panther 1 1.100 - - LDO PTHR47977
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8208
SonicParanoid 1 1.000 - - X2570
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.110

Return to query results.
Submit another query.