DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX5 and Rab1

DIOPT Version :9

Sequence 1:NP_647644.2 Gene:RabX5 / 38209 FlyBaseID:FBgn0035255 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_732610.1 Gene:Rab1 / 42524 FlyBaseID:FBgn0285937 Length:205 Species:Drosophila melanogaster


Alignment Length:215 Identity:75/215 - (34%)
Similarity:109/215 - (50%) Gaps:28/215 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 KVIFVGDCSVGKTAIVNRFCYDKFQSNYKATIGVDFELENFSILGHNYSLEMWDTAGQERFRCIA 130
            |::.:||..|||:.::.||..|.:..:|.:||||||::....:.|....|::||||||||||.|.
  Fly    13 KLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTIT 77

  Fly   131 GAYYRNASVIVVTYDMSKKDSLESAKKWLNSALNY---NASKRPLVFLVGTKADLLSKEEFVRME 192
            .:|||.|..|:|.||.:.::|..:.|:||.....|   |.:|    .|||.|:||.:|:  |...
  Fly    78 SSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNK----LLVGNKSDLTTKK--VVDH 136

  Fly   193 RLAGLAAAELQAEYWSVSARSGFKVTELFQRIAALAFEEAVMQEIRSIKNK--PQEQATQASVKS 255
            ..|...||:|...:...||:|...|.:.|..:||            .|||:  |...||..:.|.
  Fly   137 TTAAEYAAQLGIPFLETSAKSATNVEQAFMTMAA------------EIKNRVGPPSSATDNASKV 189

  Fly   256 QTFDLRNFFGSRLSQQKSGC 275
            :...     |..:...||||
  Fly   190 KIDQ-----GRPVENTKSGC 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX5NP_647644.2 P-loop_NTPase 66..230 CDD:304359 63/166 (38%)
RAB 66..225 CDD:197555 61/161 (38%)
Rab1NP_732610.1 Rab1_Ypt1 10..175 CDD:206661 65/179 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454487
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.