DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX5 and rab41

DIOPT Version :9

Sequence 1:NP_647644.2 Gene:RabX5 / 38209 FlyBaseID:FBgn0035255 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_998530.1 Gene:rab41 / 406674 ZFINID:ZDB-GENE-040426-2686 Length:211 Species:Danio rerio


Alignment Length:233 Identity:77/233 - (33%)
Similarity:120/233 - (51%) Gaps:30/233 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 DFGAQVRYYLEAPRKPKFRPCKVIFVGDCSVGKTAIVNRFCYDKFQSNYKATIGVDFELENFSIL 109
            :||..:|         ||   |::|:|:.|||||:::.||.||.|.:.|:||||:||..:...:.
Zfish     9 EFGDPLR---------KF---KLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLE 61

  Fly   110 GHNYSLEMWDTAGQERFRCIAGAYYRNASVIVVTYDMSKKDSLESAKKWLNSALNYNASKRPLVF 174
            .....|::||||||||||.:..:|.|::::.||.||::..:|.:...||::.......|. .::.
Zfish    62 DRTVRLQLWDTAGQERFRSLIPSYIRDSTIAVVVYDITNLNSFQQTSKWIDDVRTERGSD-VIIM 125

  Fly   175 LVGTKADLLSKEEFVRMERLAGLAAAELQAEYWSVSARSGFKVTELFQRIAALAFEEAVMQEIRS 239
            |||.|.||..|.: |.:| .|...|.||...|...||::|:.|.:||:|:||..           
Zfish   126 LVGNKTDLGDKRQ-VSVE-AAEKKARELGVMYIETSAKAGYNVKQLFRRVAAAL----------- 177

  Fly   240 IKNKPQEQATQASVKSQTFDLRNFFGSRLSQQKSGCTC 277
                |...:|....|....|::......|...:|.|:|
Zfish   178 ----PGMDSTPEKSKEDMIDIKLEKPPELPVTESSCSC 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX5NP_647644.2 P-loop_NTPase 66..230 CDD:304359 64/163 (39%)
RAB 66..225 CDD:197555 62/158 (39%)
rab41NP_998530.1 Rab6 17..177 CDD:206654 65/165 (39%)
RAB 17..174 CDD:197555 63/162 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0094
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.