DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX5 and Rab8

DIOPT Version :9

Sequence 1:NP_647644.2 Gene:RabX5 / 38209 FlyBaseID:FBgn0035255 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001246837.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster


Alignment Length:195 Identity:70/195 - (35%)
Similarity:104/195 - (53%) Gaps:7/195 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 KVIFVGDCSVGKTAIVNRFCYDKFQSNYKATIGVDFELENFSILGHNYSLEMWDTAGQERFRCIA 130
            |::.:||..||||.|:.||..|.|.:.:.:|||:||::....:......|::||||||||||.|.
  Fly    10 KLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQERFRTIT 74

  Fly   131 GAYYRNASVIVVTYDMSKKDSLESAKKWLNSALNYNASKRPLVFLVGTKADLLSKEEFVRMERLA 195
            .||||.|..|::.||::::.|.|:.|.|:.: :..|||......|:|.|.:|..|.: |..||..
  Fly    75 TAYYRGAMGIMLVYDITQEKSFENIKNWIRN-IEENASADVEKMLLGNKCELTDKRQ-VSKERGE 137

  Fly   196 GLAAAELQAEYWSVSARSGFKVTELFQRIAALAFEEAVMQEIRSIKNKPQEQATQAS-VKSQTFD 259
            .| |.|...::...||::...|.|.|   ..||.:.....|.|...|.|.:...|.. :.|:|.|
  Fly   138 QL-AIEYGIKFMETSAKASINVEEAF---LTLASDIKAKTEKRMEANNPPKGGHQLKPMDSRTKD 198

  Fly   260  259
              Fly   199  198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX5NP_647644.2 P-loop_NTPase 66..230 CDD:304359 62/163 (38%)
RAB 66..225 CDD:197555 60/158 (38%)
Rab8NP_001246837.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 62/167 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454500
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.