DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX5 and Rab6b

DIOPT Version :9

Sequence 1:NP_647644.2 Gene:RabX5 / 38209 FlyBaseID:FBgn0035255 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_006243731.1 Gene:Rab6b / 363123 RGDID:1309958 Length:208 Species:Rattus norvegicus


Alignment Length:244 Identity:81/244 - (33%)
Similarity:124/244 - (50%) Gaps:42/244 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LSKERDFGAQVRYYLEAPRKPKFRPCKVIFVGDCSVGKTAIVNRFCYDKFQSNYKATIGVDFELE 104
            :|...|||..:|         ||   |::|:|:.|||||:::.||.||.|.:.|:||||:||..:
  Rat     1 MSAGGDFGNPLR---------KF---KLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSK 53

  Fly   105 NFSILGHNYSLEMWDTAGQERFRCIAGAYYRNASVIVVTYDMSKKDSLESAKKWLNSALNYNASK 169
            ...:......|::||||||||||.:..:|.|:::|.||.||::..:|.:...||::.......|.
  Rat    54 TMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNLNSFQQTSKWIDDVRTERGSD 118

  Fly   170 RPLVFLVGTKADLLSKEEFVRMERLAGLAAAELQAEYWSVSARSGFKVTELFQRIA-ALAFEEAV 233
             .::.|||.|.||..|.:....|  ....|.||...:...||::|:.|.:||:|:| ||...|.|
  Rat   119 -VIIMLVGNKTDLADKRQITIEE--GEQRAKELSVMFIETSAKTGYNVKQLFRRVASALPGMENV 180

  Fly   234 MQEIR----SIK-NKPQEQATQASVKSQTFDLRNFFGSRLSQQKSGCTC 277
            .::.:    .|| :||||...                     .:.||:|
  Rat   181 QEKSKEGMIDIKLDKPQEPPA---------------------SEGGCSC 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX5NP_647644.2 P-loop_NTPase 66..230 CDD:304359 63/164 (38%)
RAB 66..225 CDD:197555 60/158 (38%)
Rab6bXP_006243731.1 Rab6 14..174 CDD:206654 62/165 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0094
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.