DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX5 and Rab34

DIOPT Version :9

Sequence 1:NP_647644.2 Gene:RabX5 / 38209 FlyBaseID:FBgn0035255 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001012140.1 Gene:Rab34 / 360571 RGDID:1305058 Length:259 Species:Rattus norvegicus


Alignment Length:275 Identity:110/275 - (40%)
Similarity:157/275 - (57%) Gaps:26/275 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LRQNLLLPQPPTVVLHDPRTHLRHLPPAYSAAQTPLSKERDFGAQVRYYLEAPRKPK--FRPCKV 67
            :|::.:|.:.|..:..:...|:|                :||..:|....:..|...  |:..||
  Rat     7 VRRDRVLAELPQCLKKEAALHVR----------------KDFHPRVTCACQEHRTGTVGFKISKV 55

  Fly    68 IFVGDCSVGKTAIVNRFCYDKFQSNYKATIGVDFELENFSILGHNYSLEMWDTAGQERFRCIAGA 132
            |.|||.|||||.::||||.|.|..|||||||||||:|.|.:||..:||::|||||||||:|||..
  Rat    56 IVVGDLSVGKTCLINRFCKDTFDKNYKATIGVDFEMERFEVLGVPFSLQLWDTAGQERFKCIAST 120

  Fly   133 YYRNASVIVVTYDMSKKDSLESAKKWLNSALNYNASKRPLVFLVGTKADLLSKEEFVRMERLAGL 197
            |||.|..|::.::::...|||.:|:||..||..|.....|:||||:|.||.:..::..||:.|..
  Rat   121 YYRGAQAIIIVFNLNDVASLEHSKQWLADALKENDPSNVLLFLVGSKKDLSTPAQYSLMEKDALK 185

  Fly   198 AAAELQAEYWSVSARSGFKVTELFQRIAALAFEEAVMQEIRSIKNKPQEQATQASVKSQTFDLRN 262
            .|.|::|||||||:.:|..|.|.|.|:|||.||..|:.|:.  |:..:.......:.|   |.:|
  Rat   186 VAQEIKAEYWSVSSLTGENVREFFFRVAALTFEANVLAELE--KSGSRHIGDVVRINS---DDKN 245

  Fly   263 FFGSRLSQQKSGCTC 277
            .:   |:..|...||
  Rat   246 LY---LTASKKKATC 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX5NP_647644.2 P-loop_NTPase 66..230 CDD:304359 88/163 (54%)
RAB 66..225 CDD:197555 85/158 (54%)
Rab34NP_001012140.1 Rab36_Rab34 53..220 CDD:206693 90/166 (54%)
Effector region. /evidence=ECO:0000250 81..89 7/7 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 178 1.000 Domainoid score I3461
eggNOG 1 0.900 - - E1_KOG0094
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 191 1.000 Inparanoid score I3783
OMA 1 1.010 - - QHG48903
OrthoDB 1 1.010 - - D1048146at2759
OrthoFinder 1 1.000 - - FOG0003705
OrthoInspector 1 1.000 - - otm44769
orthoMCL 1 0.900 - - OOG6_106322
Panther 1 1.100 - - LDO PTHR47977
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2570
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.