DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX5 and Rab9

DIOPT Version :9

Sequence 1:NP_647644.2 Gene:RabX5 / 38209 FlyBaseID:FBgn0035255 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_609966.1 Gene:Rab9 / 35221 FlyBaseID:FBgn0032782 Length:256 Species:Drosophila melanogaster


Alignment Length:229 Identity:66/229 - (28%)
Similarity:117/229 - (51%) Gaps:26/229 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LEAPRKPKFRPCKVIFVGDCSVGKTAIVNRFCYDKFQSNYKATIGVDFELENFSILGHNYSLEMW 118
            :..|:|.|.  .||:.:||..|||:|::.||..::::.|...||||:|..::..:.|..|:|::|
  Fly     4 MRPPQKSKL--LKVVILGDGGVGKSALLTRFVANRYEENNFHTIGVEFMNKDIVVDGERYTLQIW 66

  Fly   119 DTAGQERFRCIAGAYYRNASVIVVTYDMSKKDSLESAKKWLNSALNY---NASKRPLVFLVGTKA 180
            |||||||||.:...:||.:.:.::.|.:..:|||:....|.|..|||   :..|.|.: :||.|.
  Fly    67 DTAGQERFRALRTPFYRGSDICLLCYALDDRDSLKGLGVWRNEFLNYADVDQDKFPFI-VVGNKN 130

  Fly   181 DLLSKEEFVRMERLAGLAAAELQAEYWSVSARSGFKVTELFQRIAALAFEEAVMQEIRSIKN-KP 244
            |:.:::..|..:.:....|.:..|.:...|:::...||:.|               :..::. :.
  Fly   131 DIPAQKRQVSSDAVQQWCAEQKVACHIETSSKAATNVTDAF---------------VLGLRQWRH 180

  Fly   245 QEQATQASVK--SQTFDLRNFFGSRLSQQKSGCT 276
            .|...:|.::  ..|.||..  ..||.|::..||
  Fly   181 MECVAEAELRQHGDTIDLTR--PIRLVQRRICCT 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX5NP_647644.2 P-loop_NTPase 66..230 CDD:304359 53/166 (32%)
RAB 66..225 CDD:197555 53/161 (33%)
Rab9NP_609966.1 Rab9 8..178 CDD:206697 55/187 (29%)
Ras 14..177 CDD:278499 53/178 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454568
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.