DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX5 and Rab30

DIOPT Version :9

Sequence 1:NP_647644.2 Gene:RabX5 / 38209 FlyBaseID:FBgn0035255 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001245926.1 Gene:Rab30 / 33988 FlyBaseID:FBgn0031882 Length:223 Species:Drosophila melanogaster


Alignment Length:219 Identity:70/219 - (31%)
Similarity:104/219 - (47%) Gaps:27/219 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 KVIFVGDCSVGKTAIVNRFCYDKFQSNYKATIGVDFELENFSILGHNYSLEMWDTAGQERFRCIA 130
            |::.||:..||||.:|.||....|.....|||||||.::...:.|....|::||||||||||.|.
  Fly     9 KIVLVGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEVEGEKIKLQIWDTAGQERFRSIT 73

  Fly   131 GAYYRNASVIVVTYDMSKKDSLESAKKWLNSALNYNASKRPLVFLVGTKADLLSK-------EEF 188
            .:|||:|..:::.||:|.:.:.:....||.....| |:.:.|..|||.|.|...:       |||
  Fly    74 QSYYRSAHALILVYDISCQPTFDCLPDWLREIQEY-ANSKVLKILVGNKTDRDDREIPTQIGEEF 137

  Fly   189 VRMERLAGLAAAELQAEYWSVSARSGFKVTELFQRIAALAFEEAVMQEIRSIKNKPQEQATQASV 253
            .:...:..|..:..:||          .|..||..|||     .::.:.||........|..|..
  Fly   138 AKQHDMYFLETSAKEAE----------NVERLFYEIAA-----ELIGQARSKDGSSSAAAAAAQR 187

  Fly   254 KSQ--TFDLRNFFGSRLSQQKSGC 275
            :|:  :..|.:|  |..:.|.:.|
  Fly   188 QSEGSSIGLGSF--SAKAAQSNCC 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX5NP_647644.2 P-loop_NTPase 66..230 CDD:304359 60/170 (35%)
RAB 66..225 CDD:197555 57/165 (35%)
Rab30NP_001245926.1 Rab30 1..168 CDD:133314 60/174 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454577
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47977
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.