DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX5 and Rab21

DIOPT Version :9

Sequence 1:NP_647644.2 Gene:RabX5 / 38209 FlyBaseID:FBgn0035255 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001036321.2 Gene:Rab21 / 3355163 FlyBaseID:FBgn0039966 Length:222 Species:Drosophila melanogaster


Alignment Length:225 Identity:62/225 - (27%)
Similarity:103/225 - (45%) Gaps:34/225 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 KVIFVGDCSVGKTAIVNRFCYDKFQSNYKATIGVDFELENFSIL-GHNYSLEMWDTAGQERFRCI 129
            |.:.:|:..||||::|.|:..|:|.:.:.:|:...|.....|:. |....|.:|||||||||..:
  Fly    15 KAVLLGEGCVGKTSLVLRYMEDRFNAQHLSTLQASFVSRKMSLEDGRRAQLNIWDTAGQERFHAL 79

  Fly   130 AGAYYRNASVIVVTYDMSKKDSLESAKKWLNSALNYNASKRPLVFLVGTKADL-----LSKEEFV 189
            ...|||.:...::.||::.:||.:..|.|:........::..|: :||.|.||     ::.:|.:
  Fly    80 GPIYYRGSDGALLVYDITDRDSFQKVKSWVRELRQMRGTEIALI-IVGNKTDLEEQRAVTHDEAL 143

  Fly   190 RMERLAGLAAAELQAEYWSVSARSGFKVTELFQRIAALAFEEAVMQEIRSIKNKPQEQATQASVK 254
            :..|..|       |:|...||:....|.|||:.:..|..|:.           .|.|...:.::
  Fly   144 QYARTVG-------AQYVETSAKENEGVAELFELLTQLMLEQL-----------SQRQPDASPLR 190

  Fly   255 SQTFDLRNFFGSRLSQ---------QKSGC 275
            .|..|..|...|..|:         |:|.|
  Fly   191 LQNPDTDNLNNSDDSEAPDPGDPAGQRSCC 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX5NP_647644.2 P-loop_NTPase 66..230 CDD:304359 51/169 (30%)
RAB 66..225 CDD:197555 50/164 (30%)
Rab21NP_001036321.2 Rab21 14..176 CDD:133323 51/168 (30%)
Ras 15..177 CDD:278499 51/169 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454550
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.