DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX5 and Rab5

DIOPT Version :9

Sequence 1:NP_647644.2 Gene:RabX5 / 38209 FlyBaseID:FBgn0035255 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster


Alignment Length:165 Identity:57/165 - (34%)
Similarity:88/165 - (53%) Gaps:13/165 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 KVIFVGDCSVGKTAIVNRFCYDKFQSNYKATIGVDFELENFSILGHNYSLEMWDTAGQERFRCIA 130
            |::.:|:.:|||:::|.||...:|....::|||..|..:...|.......|:||||||||:..:|
  Fly    31 KLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQERYHSLA 95

  Fly   131 GAYYRNASVIVVTYDMSKKDSLESAKKWLNSALNYNASKRPLVFLVGTKADL--LSKEEFVRMER 193
            ..|||.|...:|.||:..:||.:.||.|:.. |:..||...::.|.|.||||  :...||...::
  Fly    96 PMYYRGAQAAIVVYDIQNQDSFQRAKTWVKE-LHKQASPNIVIALAGNKADLSNIRVVEFDEAKQ 159

  Fly   194 LA---GLAAAELQAEYWSVSARSGFKVTELFQRIA 225
            .|   ||.       :...||::|..|.::|..||
  Fly   160 YAEENGLL-------FMETSAKTGMNVNDIFLAIA 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX5NP_647644.2 P-loop_NTPase 66..230 CDD:304359 57/165 (35%)
RAB 66..225 CDD:197555 55/163 (34%)
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 57/165 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454248
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.